Entry information : HaTrx04 (HanXRQChr11g0341201)
Entry ID 14492
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx04 (HanXRQChr11g0341201)
Name (synonym) HaTrx04 (HanXRQChr11g0341201)
Class Other Thioredoxin    [Orthogroup: Trx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx04
start..stop
S start..stop
ThasTrx04 239 3e-82 7..175 20..184
AtTrx04 236 4e-81 36..175 45..183
AtTrxY02 64 0.0000000000001 12..175 23..163
ThasTrxX01 64 0.0000000000001 84..173 87..176
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 116361653..116361859 207 N° 2 116362272..116362394 123 N° 3 116363331..116363411 81 N° 4 116364316..116364432 117
join(116361653..116361859,116362272..116362394,116363331..116363411,116364316..1 16364432)


exon

Literature and cross-references HaTrx04 (HanXRQChr11g0341201)
DNA ref. HanXRQ genome:   HanXRQChr11 (116361653..116364432)
Protein sequence: HaTrx04 (HanXRQChr11g0341201)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   19559.07  
PI (pH):   %s   5.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLAPTPFSFCAPPKLLSSATLSHPLKQRDAVTIFSTTTKSPVSSIQSSPRKLLATPPPGKFLRQDYLVKKYSAKEIQELIKGERNVPLVIDFYATWCGPCILMAQELEMLAVEYESNAMIVKVDTDDEYEFARDMQVRGLPTLYFISPDPNKDAIRTEGLIPLQMMRDIIDNSM*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACTCGCACCCACACCCTTTTCATTCTGTGCTCCACCAAAGCTTCTATCTTCTGCAACTCTTTCTCATCCCCTAAAACAAAGAGATGCTGTTACCATATTCTCCACCACAACAAAA
TCCCCTGTTTCTTCCATTCAATCTTCACCAAGAAAGCTGCTTGCTACACCCCCTCCAGGAAAATTTCTCCGACAAGATTATCTTGTT
GTATGTTTTACTCTATACCCACTTCACACTTGT
GTTAATTTTGCATAAAGTTATTGTCTTTTTTATGGGTTTTGTGTATAATTTGAGATATGGTAAACAATATGGCAAAACTCCCACCCTAATTGCTTTAATTCATATGGGTATTGTGGCAAT
TTTGACTTTTGAAGTCAATGTTCTGACTTTCTTTAGGAATTTTGATAATTGGTAGTTATAATTTCTGGGTGTTTTGTTTGTTTCTTGAAAATCCCCTTTTGTAGAGTAAAGAGAGGAGAA
AATGATTTGGAAATTGATGCAAATTTGAAAGTTTTAACTATGTTGGTAGTTTATAGGTTTATATAGTCTTTGTGTATTTGGATTTCTTTGAGGTTATGTTTTTGGTTTAATGGTTTTATG
TTTTGGATTTGTGTTGCAGAAAAAGTATTCTGCTAAAGAGATTCAGGAACTGATAAAAGGAGAAAGAAATGTACCGTTGGTTATAGATTTTTATGCAACATGGTGTGGGCCTTGTATATT
GATGGCTCAAGAGCTTGAAATG
GTATGGCTATGATTTGCTTATGTATAAGAAGCTATGAAAGCTACACGTATGATATATGTGATGTTCGGTTCGTTTAGGTTGTGTTGACATGAATGTGT
CATAACGTCATTAACATAATCTTTTTTCTTTGTAACACATTATTTTGAAAACTGTACAAAGTATGGTAGATAGGATCAAACGCTCGATGCAGAAGTTTATTTGTTTAAAGAGTTAAATGC
CATTTTAGTCCCTGTGGTTTGGTCCATATTGCCAGTTTAGTCCAAAGGTTTCATTTTTCGCCTGCGGATCCAAAAAGGTTTCACTGTTGCCATTTTAGTCCACTGGGTTAACTTCATCCA
TTATTTCTGTTAACGAGCAGGGCAATTCGGTCATTTTATATGGCTGAATTGCCTTTCTAGTAAACAAAATTACATATAAAATGACCGAATTGCCATGCTCGTTAACAAAAATAATGGATG
AAGTTAACCCAGTGGACTAAGATGGCAACAGTGAAACCTTTTTGGATCCGTAGGCGAAAAATGAAACCTTTGGACTAAACTGGCAAAATGGACCAAACCACAGGGACTAAAATGGCATTT
AACTCTTTTTTAAATATTCGAATTATGTGAAATAATTATTGTGTATTAAATACTTAAGACGATGATGATTATGCCTTTTGACAGGATTGGGATGATTATGGTGTTCTGTTATTAAGTGTT
TTGACTCCATCTATTTTGCTAGTAAATAGGTCCAAAAACCAGTATCACCTAATTTGCTACATGAGTTGTTCATTGTTTAAATACGCGCGTATGATGTATACACAGAATAATATTAATATA
GCAAATTAGCAGATATGTATTACAATTAGTGAATTGGGATAAAAGGCTTATTTTTGTTGAACCGTATACAATAATGGTTAACACTGATAGGTTCCTTGAATTTAATTCCTTTCTACAGCT
TGCAGTCGAGTACGAAAGTAATGCTATGATAGTGAAGGTGGACACAGATGATGAGTATGAATTCGCACGTGATATGCAG
GCAACTCCCTCATCTCTTCTTGTTTAGTCGTCTACATTATG
TTTCAATCACCTTTTGCTTATTGGTCTTATAAGTATGTCTACTTAACCGTATCTAGTGAAGGCATACTTGTAAGTTACTTTTTATTTTTCATCAGGAGAAATTGATTAAAAAACGATATA
ATAGCAAACTCTTTTTTAGAGTAAATTACAAAAAGCGTCCTTTATGTATGTCACTTATTGCAAACTGTGTCCTTTGTCTTCAATAATTACAGAAAACGTACTCGACGTTTGCAGACCCTT
GCAAGTTATGTTCTTTAGCCCTAACTCAGTTAATTTTTTGTGGTTAAATCTGACCAAATGGACCCCACATGAGGGTATTTTGGTCATTTTACTCTCATGTGAGGTCCATCTGTTCAGATT
TAACCACAAAAATACCCTCATGTGGGGTCCATTTGGTTAGATTTAACCACAAAAATTAACTGAGTTAGGGCTAAAGGACATAACTTGCAAGGGTTTGCAAACATCGAGTACGTTTTCTGT
AGTTATTGAAGACAAAGGACACAATTTGCTGACATACATAAAGGACGATTTTTGTAATTTACTCCTCTTTTTTATTAGTTTAAAGTAATGGGTTTTAATTTGCACTTTGAAACTAGTTTA
TATGAGCAGTTTTTAGTGTTTGAATAAACAGATTCTGTTTCCCAGTCGTCTTATACTCTTATTATTTACGGGCGATATAATGTTCATATATGCCACCCTTCCTTTCTTGTAATCTAATGT
GATCGACTTCTCATCCATCTCTTATTTGATTGTGATTAATTGACACTAATAATCACTTTCAGAGAGCATTCCTTTGTTCAAGAACAAACCATAAATATTTTTCATTTGTAGTATAATAAA
TATGATTGTTACATGACTGACAGGTAAGAGGTCTACCGACATTGTACTTTATTAGTCCCGATCCAAACAAAGACGCAATTAGAACCGAAGGCCTCATTCCGCTTCAAATGATGCGCGATA
TTATTGACAACTCCATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACTCGCACCCACACCCTTTTCATTCTGTGCTCCACCAAAGCTTCTATCTTCTGCAACTCTTTCTCATCCCCTAAAACAAAGAGATGCTGTTACCATATTCTCCACCACAACAAAA
TCCCCTGTTTCTTCCATTCAATCTTCACCAAGAAAGCTGCTTGCTACACCCCCTCCAGGAAAATTTCTCCGACAAGATTATCTTGTT
AAAAAGTATTCTGCTAAAGAGATTCAGGAACTG
ATAAAAGGAGAAAGAAATGTACCGTTGGTTATAGATTTTTATGCAACATGGTGTGGGCCTTGTATATTGATGGCTCAAGAGCTTGAAATG
CTTGCAGTCGAGTACGAAAGTAATGCTATG
ATAGTGAAGGTGGACACAGATGATGAGTATGAATTCGCACGTGATATGCAG
GTAAGAGGTCTACCGACATTGTACTTTATTAGTCCCGATCCAAACAAAGACGCAATTAGAACCGAAGGC
CTCATTCCGCTTCAAATGATGCGCGATATTATTGACAACTCCATGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAAGTTTG CAAAACCCTC TCTCAAAACC TCTCCTCCCC TCTATCCATC TAAAACATTG AAAAACCCTC TTCAAACCTT CCTCTTTATC CATATCTTCA GGATCATCAA CCAAAATGCT  ACTCGCACCC ACACCCTTTT CATTCTGTGC TCCACCAAAG CTTCTATCTT CTGCAACTCT TTCTCATCCC CTAAAACAAA GAGATGCTGT TACCATATTC TCCACCACAA CAAAATCCCC  TGTTTCTTCC ATTCAATCTT CACCAAGAAA GCTGCTTGCT ACACCCCCTC CAGGAAAATT TCTCCGACAA GATTATCTTG TTAAAAAGTA TTCTGCTAAA GAGATTCAGG AACTGATAAA  AGGAGAAAGA AATGTACCGT TGGTTATAGA TTTTTATGCA ACATGGTGTG GGCCTTGTAT ATTGATGGCT CAAGAGCTTG AAATGCTTGC AGTCGAGTAC GAAAGTAATG CTATGATAGT  GAAGGTGGAC ACAGATGATG AGTATGAATT CGCACGTGAT ATGCAGGTAA GAGGTCTACC GACATTGTAC TTTATTAGTC CCGATCCAAA CAAAGACGCA ATTAGAACCG AAGGCCTCAT  TCCGCTTCAA ATGATGCGCG ATATTATTGA CAACTCCATG TGAAAGAAAG AAACCGAAGA TGAGTGATTA TTTTTTCCTG CATGTGTTGA AAAGTAGAGT AGATATATTA AGTTCATTTG  TTGTTACTTT TAGCACATTA AAGTTGTCAA GTGTATTGAT AAGATTAATA GCACTTTTTG TTAGGTTAAA GACTCTGTAT CAATCTTTGT GAGCGGATTA TTTGTATCGA GAGCAATGTA 
CTTTGGTTTA GAAACCCATC GGTCTACTTA AAAACATCTA GACTATTATG TCCGAAACAT AATATTATGA GCTCTCTAAC GACTTTCGTA TCTTTAT 

Retrieve as FASTA