Entry information : HaTrx05 (HanXRQChr11g0350471)
Entry ID 14493
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx05 (HanXRQChr11g0350471)
Name (synonym) HaTrx05 (HanXRQChr11g0350471)
Class Other Thioredoxin    [Orthogroup: Trx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx05
start..stop
S start..stop
ThasTrx05 190 1e-64 7..122 3..118
AtTrx05 176 5e-59 10..122 14..126
PpaTrx02 141 5e-45 1..122 16..137
KflTrx02 98 2e-27 17..121 31..133
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 157411590..157411712 123 N° 2 157411813..157411838 26 N° 3 157412797..157413016 220  
join(157411590..157411712,157411813..157411838,157412797..157413016)


exon

Literature and cross-references HaTrx05 (HanXRQChr11g0350471)
DNA ref. HanXRQ genome:   HanXRQChr11 (157411590..157413016)
Protein sequence: HaTrx05 (HanXRQChr11g0350471)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   122
PWM (Da):   %s   13881.76  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANTKTTNTHNQTNPNGNLITATNDEHLRGIFHQIRTSKSPAVINFGASWCRVCADILPSFNHLSSKFPKLSFVYADIDECPETTQHIRYTPTFHFYRDGERVDAMFGAGEERLHDRLWLHS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAACACAAAAACAACAAACACCCACAATCAAACAAACCCCAATGGTAACCTCATCACTGCAACAAACGATGAGCATCTCAGAGGCATCTTTCATCAAATCAGAACTTCAAAATCC
CCT
GTATATGAATCTTCACTACTTCTAAATCAATTTGCTTCATCATCTTCGTTATAATTCTGCTTTTTTAGTTCTTAATTATATGATTTTTATCCAATTTCAGGCTGTCATCAACTTCGG
TGCATCTTG
GTATGTCAATTGCTGATTTATAAACAACAATTTTGTTTTTATTAAAGGGGTACGATTTTAGAACTGTAGAGTACAGATTGATAATTTCACAGTTTTAAGTTGAGAGTGTTT
GAGATTGTGAAACTAAAGTTGAAGATAAGGTGTTCGATGAAATGCCTGAGTGAATGTGGTTTCATGTAGAGGGGCACAAATAGGTTTTTTTTTAATCCCAAACCGGTTCGGTTTTAGTCA
AAGATGGTCAAAACCGGTGTTTGTTTAAACCTGTTTGGTTTTGAGACTGGTTTCCAAGTGGAAACGGAACGGTCCGCTTTGAAATCGGTTTGTAACTTGTTCGGTTTCAACGAAAGAGTT
CTAGGTATCAAACCGGTGGTTCGGTTTGAAACCGGGACCAGTTTATAATAGGTTTCAGTTTAGGTTAAATAGGTTTCTGAGCCCAACCGGTCCGGTTTCGGTCAAAGATGGTCAAAACAG
GTTCTTTCCCAAACTATTCGGTTTTGAAACCGGAAAAGGATTGGTGAGGTTTGCAACCGGTTTTTAAGCGGCTCGGTTTCAATGGAGTTTTCAAACCAATATCAAACTGGCGGTTTGGTT
TGAAATCACTTTTTAAGCGGCTCAGTTTCAACGGAGTTTTCGAACCAATATCAAACTGGCGGTTTGGTTTGAAACCGCGACCAGTTTTTGATAATCAGTTTCGGTTGGGGTTAAAAACTG
GTTTCGGTTCACAAGACAGTTCATATGTTCACCTCTAGTTTATAGTTGTCAATAGCGGTCTCTATAGCGAATAGTGTAGCGTATAGGTCGAAGGTCGCTACAGGGTATGTAGCCATAAAT
AGCGGGATTTCAGTTATTTTTTTAAAGAGTTAAATGTCATCGTTTCCCTATCATCCGAACACATAGATCCGCCCTTGACCGTGATCATGTTTAAACTAAAATTTGTATATTTTATTGTTG
TTTACAGGTGTCGTGTTTGTGCGGATATTCTCCCTTCGTTCAACCACTTAAGCAGCAAGTTCCCAAAACTTTCTTTCGTGTACGCAGACATCGACGAATGCCCAGAAACAACCCAACATA
TTCGATACACGCCTACGTTCCACTTCTATAGAGACGGTGAACGGGTTGATGCCATGTTTGGTGCCGGTGAAGAGAGGCTGCACGACCGTTTATGGTTACACTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAACACAAAAACAACAAACACCCACAATCAAACAAACCCCAATGGTAACCTCATCACTGCAACAAACGATGAGCATCTCAGAGGCATCTTTCATCAAATCAGAACTTCAAAATCC
CCT
GCTGTCATCAACTTCGGTGCATCTTGGTGTCGTGTTTGTGCGGATATTCTCCCTTCGTTCAACCACTTAAGCAGCAAGTTCCCAAAACTTTCTTTCGTGTACGCAGACATCGACGAA
TGCCCAGAAACAACCCAACATATTCGATACACGCCTACGTTCCACTTCTATAGAGACGGTGAACGGGTTGATGCCATGTTTGGTGCCGGTGAAGAGAGGCTGCACGACCGTTTATGGTTA
CACTCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACAAAATTT GCAATTTACT CTTTAAAGAT ATAGAAACCA ATTTTAGGTA AGGGGTGAAG TCCTCATCCC CCATAGCTAA CGAGAACGCA AACATGGCGA ACACAAAAAC AACAAACACC  CACAATCAAA CAAACCCCAA TGGTAACCTC ATCACTGCAA CAAACGATGA GCATCTCAGA GGCATCTTTC ATCAAATCAG AACTTCAAAA TCCCCTGCTG TCATCAACTT CGGTGCATCT  TGGTGTCGTG TTTGTGCGGA TATTCTCCCT TCGTTCAACC ACTTAAGCAG CAAGTTCCCA AAACTTTCTT TCGTGTACGC AGACATCGAC GAATGCCCAG AAACAACCCA ACATATTCGA  TACACGCCTA CGTTCCACTT CTATAGAGAC GGTGAACGGG TTGATGCCAT GTTTGGTGCC GGTGAAGAGA GGCTGCACGA CCGTTTATGG TTACACTCCT AACTAAAATA GCTTAAACCA  AATGTTGCAA TGCAAGTCAC TTTTATTTAT GTAATCTTCA TAACATAAAC TATTTTAAAT CAAATGGAAT TGCTTTATAG TTTATATAAT AGAAAACATA CACACATTTC CAATCAAACA  AAACAAAAGA GATAACCATA AACCAAAGTT CCGATCCGAG GGGTAAAACC GTAAAAGTGT CGTTTTACTC AAGCTTTCGG TTTGAGAATC TTCGGAGTCT CCCAGGTGAA ATCGGGATCG  TCACGACCAA AATGACCATA CGCGGCGGTC TTCTGGTACC TGTAATTGCC ACCCCTCTTC AAGTCGAGGT TAATCGCCAT CATCCCGGGC CTAAAGTCGA AATTCTCCTT GATCAGAGCA  AGGATATCCT TATCCGGGAT CTTTCCGGTT TTGTACGTGT CGACAAACAC AGACAACGGT TCGGCCACAC CAATAGCGTA AGAAACCTGA ACAATGCACC TGCGTGCGAG CCCCGAAGCC  ACTACGCTCT TGGCCGCTTG CCGAACAATA TAAGCCCCGC TCCTATCCAC TTTCGTCGGG TCCTTCCCGG AGAACGCGCC GCCGCCGTGA GCTCCCCATC CACCGTACGT GTCGATTATA  ATCTTCCTTC CGGTGAGACC CGCGTCACCG TGGGGACCAC CAATCACAAA CCGGCCAGAC GGGTTTAAGT GGAAGATAGT GTTTTCATCA AGATACTTAG ACGGGATCAC GGGCTTGATC  ACGTGCTCTT TGAGATCAGC CGCGATTTGG TCGTTAGTCA CGGTCTCGTC ATGTTGTGTA GAGATGAGAA CCGTGTGAAC CCGGATTGGT ACCATAGCAC CGTTGTCGTT TCGGTACTCA  ACCGTCACTT GGGTCTTTCC ATCGGGTCTG AGCCATGGGC AAGTCTTGTT CTTTCTAACC TCGGTTAGTT TAGCCCCGAG CTGAGTCGCT AACACGTGTG TTAGCGGCAT AAGCTCAGGA  GTTTCATCGG TTGCATAACC AAACATGTGA CCTTGATCAC CGGCCCCAAT CTCTTCCGGC TTCTTGCTGA GGTGTCCGTG CACACCCTGA GCGATATCCG GGCTTTGTTG CTCGATGTAG  ACTAGAACGT TGCAGTTGTC AGCGTCGAGC CCGACTTCCG GAGACGTGAA CCCGATGTTT CTACAAGTTG TACGGACGAT CTTTTCGTAG TCGACATTAG CCTTTGTGGT GATCTCACCA  AAGACCATAA CCATATTCGT CTTCGTGCAT GTTTCGCAGG CCACTTTGCT TTCGGGATCT TGTTCTAGAC ATGCGTCGAG AATGGCGTCC GAGACTTGAT CGCAGAGTTT GTCTGGGTGT  CCTTCGTTGA CCGACTCGGA TGTGAATAGG AAGGTCTCCA TCTCTGTGAC AAATAGATAC AAAATTCCAC AACATAAGCT CAAATTCAGG AAATGAAAAA TCAGATCACA GAACTAGAAA  TCAACATAGG GATAGAGATC GTTACCGGTA CCGATACCGT ACCTCATAGT ACCGATACCG AAATTTAGCG AAAGCTAAAA CTGAATATTG TACCGTATAT GTTCGGTCAG TGCCAGTATC  ATATACATAG GGATACCGAT ACTGAAACTA AGCTAAAACT AAAACTGAAT GTTGTACCGT ATATGTAATT TAGCTAAAAC TAAAACCAAA TATCGTACCA TATATGTTCA GTCAGTGCCA  GTATCATACG CAAATTCAAG TAATGAAAAA TCAGATCATA AAACCAGAAA TCATATAGTT GTGAGATCGG TACCGGTACG TACAACACAA TATCGATGCC GAAATTTAGC TAAAACTAAA  ACCGTATATG TCCGGTTAGT GCCGGTATCA CACCACATAG TACCGATACC AAAGTTAAGA TAAATTCAAA ATCAAATTCT GTACTGTATA TTTTTTGTCA GTACTGGTAT GAATGCATGA  TATGATATGA TATGATATGG TATAGTACCG TACCAGTATG GTACAGTACT AGTATGGTAT CGTTATCCCT AAATCGATAT CCGAATCGAA ATTTTGGAAT TAAATTTGAT ATAATAAACG 
TAAAATGAGC ATACCCTTAA TTGATGTGGA TATTGAGAGA GAGATATGAA GAAGAACAAC A 

Retrieve as FASTA