Entry information : HaTrx07 (HanXRQChr13g0390541)
Entry ID 14495
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx07 (HanXRQChr13g0390541)
Name (synonym) HaTrx07 (HanXRQChr13g0390541)
Class Other Thioredoxin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx07
start..stop
S start..stop
HaTrx01 302 7e-107 1..187 1..188
AtTrx08 179 6e-58 1..187 26..210
ThasTrx08 171 7e-55 53..187 56..193
AtTrx07 144 2e-44 51..185 55..188
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27251904..27252208 305 N° 2 27249067..27249141 75 N° 3 27248758..27248824 67 N° 4 27248438..27248455 18
N° 5 27248259..27248357 99  
complement(join(27248259..27248357,27248438..27248455,27248758..27248824,2724906 7..27249141,27251904..27252208))


exon

Literature and cross-references HaTrx07 (HanXRQChr13g0390541)
DNA ref. HanXRQ genome:   HanXRQChr13 (27252208..27248259)
Protein sequence: HaTrx07 (HanXRQChr13g0390541)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   187
PWM (Da):   %s   21594.04  
PI (pH):   %s   9.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVLSSSSHLFQRELHHRDLQQPQHPNWSNGYRSNPTKTHGFGFDRRKMDRWTKVFKKDCKVEAFGDISRPFVEMEPITDADHLNVVLEQAKQASQPVIIDWMATWCRKCIYLKPKLEKLAAEYDIKIKFYCVDVNNVPQALAKRGKIKMPTIQLWKDGEMKSEVIGGGKVSLVIEEVREMIQNFV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGTTTTATCATCAAGTTCCCATCTTTTTCAAAGAGAACTCCATCACAGAGATCTACAGCAGCCACAACATCCAAATTGGAGTAACGGGTATCGATCAAATCCAACAAAAACACAC
GGGTTTGGTTTCGATCGAAGAAAAATGGATCGATGGACAAAAGTTTTCAAAAAAGATTGTAAAGTTGAAGCCTTTGGGGACATATCAAGACCTTTTGTAGAAATGGAACCTATAACTGAT
GCTGATCATTTGAATGTTGTTTTAGAACAAGCAAAACAAGCTTCTCAACCCGTCATCATTGATTG
GTATACATTCTTTCTCATTTTTGTTTGGGTGTATGGATTGCAAGAGTTAAGTGTC
ATTTACATCCCTGGTTTGTTCATTTTTGTCAATTCATGTCAAATTTCAAAATTGCACTATTTATATTCTCAAAAAAACATGTCATTTTAGTCTAAAAAAACTAACCCAGTTAAAAAAACT
CATAACTAATTTATCCCAAGGACGTAAATGGCACATAAACTATAGAGACAAAAATGACATATAATTTCAAGATTTTTTTATTTTTTAAATTTCTTTTTATTATTATTATTATACTACTAC
TAATAATAATAATAAAAAAAAGAAATTTAAAAAGTAAAAAAATGTTGAATTTATGTGTTATTTTTGTCCCTATACTTTACGTGTCATTTACGTCGCTGTGATAACCGAGTTATGAGCTTT
TTTAATGGTTTAATTTTTTGGACTGAAATAACACGTTTCGATTATGTCAGGGAGGAAAATTGTACAATTTTAAAGTTTTGCCTGAAGTGGCAAAAGTTAATAAATCACAGGACCGTAAAT
GACACTTAACTCGGATTGCAATTACAAAGTGATTGGATGTAAACCAATTAAGGTTATTCCAACGCGTAAAATAATTTTAAAACGCAATTCCAAACGCCTAACTAGGGCCGGCTCAACCAT
TTTAGAGGCCTAAAGCAAGTTTCAAAATTGGGGCCGTTCTTGCCTATTTTTTTTCTTATCCAAAAAGAATAAAAGACGGTCGATCAGTCTAAACGAGATTCGAACCCGCCTCCTTAAGGT
TCACAGATTACATGCGCGCCAACTAGAGATAGGCATAATAACCAGTTCCAAACTTGAACCAGTAGAACCGACCCGTACCCGGTTCCAGTTCCAACCCGATGTATAGAAGAACCGGTTCCG
GGTTCAAAATACCCGGTGGTTCTTAACCGGTTCCATATTTCTTGATAATAAACGGGTCGTACCCGGTCAGTACCCGTACCCGGTTCTTCCAGTACCCGGTAATAAGATACTGTTAGAACC
GGTTACTAGCCGTTAGAATCGATTCTTGGAGGTTGCAAAAAGCATTAAACACCAAACATAACTAAACATAACACACCAAACTTAACTAAACAAACGGGTTACATCAAACACACTAAACAT
TTGAACAACCGGTCCTGGATCATTCACCCTTTTCATTTTTTTCGCCTTGGTCACCGGGCAATGGCGGTCGATGTGTTTCTTTAGCGTCGAGTTGGCGGCCGCTTTCATGAACTTTCCGCA
ACCTTTGCACCTAGCCATCTCATGGTTATCGGTCATCAAACACAAATCGAAATGCTTCTGAAGAAACCCTGGTTTAATTGACCGAAATCAACTGAACCAGGGGGTTTGAATCTGCATAAA
AGGGTTAAATTTTCTCGTCCGATTCGCGGGTGACTGACCTTCTTCCTCGAACAATTACTGCAAAACAACAGCCGTTAGACTCGCCACGGGGAGAATGGAGGTTCTCTCCGTGACCACCCT
CCGGCGTGAGAATAAGTACAAGTTTTGATGAAGAAGAAGAAGTGTAAGTGAAGTGAATGTAACTTGAGAATTATACCTGAATTATCCTTCTATTTATAGCCGAAGTTTGGGCGGGAAAAC
CTGTTGGTGAAAACTTGACGGAAGATGCTTTTCCGTAAGCGGTTATTCTTTCCCTCCGTTAATCATTAACGAGTGTGTAAGCACACGGATCGTGATCTTGATCAACGGTTGGGGTATTGC
CACGTGGAAAGTGGGCAAGTGTGGGTTTCTCTTCAATCCCATGCCATCATCGTGACTTTGAGAGAGCCTGGGATGATGCCACGTGGCCATTCGGTTATAACCGAATGGTGGTGCACGATG
GAGTCTTCTAGAAGAATACAGCTGTAATCCTGTGTGGCTCTTCTTTATGTCCATTGTATGGTATCAAAGAAGTTATTTTTATCCGAGTCTGGATATTGATTATGCGGAAGTGTTTGTTAG
GATTTTTATCCTTTTTGCTATGGAGGTCGGCGCAAGGATTTGTTAATCTCCTTTTGGCGTGCAGGTGTTGATCATTGTTTTCTTTCTAAGTTCTCTTTGTAGGACCAGTGCGCGGCCGCA
CAAGGTCTAAAGAGGGTTTACTGACGAGGTTATGGTATGGTCCTAAACACTTAAAGCAAGGTTTTTGTGACCTTACCCCTTCAGCTTCCAAATTGACGGGTTTCGTTTGGTTTCCATAAC
CATAACAACCTCGTCATTGCATGCCATTGTATCTTCGAAAATATGAAATCAAATATTGAAGTGTTGAATGTTTGCAGTAGTAAAGAAAGAGAATGGAGAAGATGAGGTATATATACAAAA
AAAAAACGATTTTTATATTCTGGTATTATATCTGTTGGAACCGGTTCCAAACAGTAACTGGCAGCTTTTGGTTTGAAAAACCCGACGTAACCGGTTCTGGTCAGTACCCGGAACCGGGTC
CAGAGTACCTGTAACCGGTTACATCAGTTCTAGTTTTATTGACGACTACCTGGGTTCAACCCGGAACCGGTTCTTTAGAGAACCCGGTTCCACTAACTAGTATCAGTACCCGGGTACGGG
TAGGAACCAGTTCCGGGTATTAATAATACCCGATTATGCCCATCTCTAGCCCCAAGCCTCAAAATACTTGGGCTTGGGCTGCGCCCAACTACTGTTTAAGAATGCGGATTACTTGAGTAT
TTTGATATTTTTTCTGGTTTTTAAGATTATGTAGGAATGCATGATGAGTTATTTGTGATTTGTGTAGGATGGCTACTTGGTGCAGAAAATGCATATACTTGAAGCCAAAATTGGAGAAAC
TTGCAGCTGAATATGACATCAA
GTATTTTCTCTAAATTAATTGTGTATATAAATAGTTTAATGTGAGTTCATATAATCATCTCACTTTTCTATCTCTTATTTCTTTATCACACATGCATT
ATAGACTTATATGTTGTATATTATAATAAAATCCATACTACGACTAGACAACAAAAATAGTATTATAAATCTGAGCCCGAAGAGATTAGTATATATCTAACAATTTTTTTATTTTTTTTA
TTTTTCCTCAAAATGTTTAATTAGGATCAAATTTTATTGTGTGGATGTGAACAATGTACCACAAGCACTCGCAAAACGTGGAAAGATCTCTGTACGTATAGCTTTTCAAATTTAAATCCT
ATGAATGTTGTTATAATGTTACTAATGATTCACTTATTTCTTTTTGTTATTAACGCTACTTTTGTTTGTTGATGAGTCGAGATCTGTCATATCACTTTTTGTGTGTCAATAAATGTCCAG
TATGTATTATAGGTTTGTACTATAGAACGTAATGTAATACAAAAGCACATGATGCAAATTTGTATGTTCTATAGTAAAAACCTATACTGCAAATGATACATAGGTGAAACACAAAAGGTG
AGACAACAGATCTCAACTCGTTTGCCAATGCAGAAAATGCCGACAATTCAGGTGCGTTTAGAATCATGAATACTATCTCATTACTTGGATCACGAATTTTATGCTCATTATTTAGATTTG
CGTTCATGTAGTTGTGGAAGGATGGAGAGATGAAATCAGAAGTGATTGGTGGGGGTAAAGTATCGCTTGTGATCGAAGAAGTTAGAGAAATGATTCAGAATTTTGTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGTTTTATCATCAAGTTCCCATCTTTTTCAAAGAGAACTCCATCACAGAGATCTACAGCAGCCACAACATCCAAATTGGAGTAACGGGTATCGATCAAATCCAACAAAAACACAC
GGGTTTGGTTTCGATCGAAGAAAAATGGATCGATGGACAAAAGTTTTCAAAAAAGATTGTAAAGTTGAAGCCTTTGGGGACATATCAAGACCTTTTGTAGAAATGGAACCTATAACTGAT
GCTGATCATTTGAATGTTGTTTTAGAACAAGCAAAACAAGCTTCTCAACCCGTCATCATTGATTG
GATGGCTACTTGGTGCAGAAAATGCATATACTTGAAGCCAAAATTGGAGAAACTT
GCAGCTGAATATGACATCAA
GATCAAATTTTATTGTGTGGATGTGAACAATGTACCACAAGCACTCGCAAAACGTGGAAAGATCTCTAAAATGCCGACAATTCAGTTGTGGAAGGATGGA
GAGATGAAATCAGAAGTGATTGGTGGGGGTAAAGTATCGCTTGTGATCGAAGAAGTTAGAGAAATGATTCAGAATTTTGTATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAAACATCC AATTTCAATC TCAAAGCCCT GAATTCCATT AAAAAAAAAA AAAACAAATT TATTTTTACT AAATTCCCTT AGTCCTAAAA TATCTATTAT TTTCAAAGGT CTCCTGTTCA  TCAATACCAC AAACGAAACC AGTAGCACAA ATGTCAGTTT TATCATCAAG TTCCCATCTT TTTCAAAGAG AACTCCATCA CAGAGATCTA CAGCAGCCAC AACATCCAAA TTGGAGTAAC  GGGTATCGAT CAAATCCAAC AAAAACACAC GGGTTTGGTT TCGATCGAAG AAAAATGGAT CGATGGACAA AAGTTTTCAA AAAAGATTGT AAAGTTGAAG CCTTTGGGGA CATATCAAGA  CCTTTTGTAG AAATGGAACC TATAACTGAT GCTGATCATT TGAATGTTGT TTTAGAACAA GCAAAACAAG CTTCTCAACC CGTCATCATT GATTGGATGG CTACTTGGTG CAGAAAATGC  ATATACTTGA AGCCAAAATT GGAGAAACTT GCAGCTGAAT ATGACATCAA GATCAAATTT TATTGTGTGG ATGTGAACAA TGTACCACAA GCACTCGCAA AACGTGGAAA GATCTCTAAA  ATGCCGACAA TTCAGTTGTG GAAGGATGGA GAGATGAAAT CAGAAGTGAT TGGTGGGGGT AAAGTATCGC TTGTGATCGA AGAAGTTAGA GAAATGATTC AGAATTTTGT ATGATTTTCT  CCCTAATTTT ACATTCAAGT TCTTGTTCAT ACATATACAT ACTAGCTTAA CAACCCGTGT ACTATACGGG TAGCATATAT ATAATGTGAA AATAATTTGT TCATATCTCG TAATTACACA  ACTTATAATG ATAATTACGC GACTCATGCT ACAATAATAC TTTATACCAA GATTTATGTG CAGTTCATTT GTTCCATTTA GTTCGTCTGT CTTACGATAT TTATACACTT TATGCATTTA 
GCTTCAAGA 

Retrieve as FASTA