Entry information : HaTrxH02 (HanXRQChr03g0092831)
Entry ID 14498
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH02 (HanXRQChr03g0092831)
Name (synonym) HaTrxH02 (HanXRQChr03g0092831)
Class Thioredoxin Type H    [Orthogroup: TrxH004]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH02
start..stop
S start..stop
AtTrxH02 147 4e-47 2..122 12..132
ThasTrxH02-2 144 7e-46 1..122 9..130
ThasTrxH02-1 143 1e-45 1..121 9..129
HaTrxH07 142 4e-45 11..122 22..133
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 165500428..165500544 117 N° 2 165500689..165500811 123 N° 3 165501171..165501302 132  
join(165500428..165500544,165500689..165500811,165501171..165501302)


exon

Literature and cross-references HaTrxH02 (HanXRQChr03g0092831)
DNA ref. HanXRQ genome:   HanXRQChr03 (165500428..165501302)
Protein sequence: HaTrxH02 (HanXRQChr03g0092831)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   123
PWM (Da):   %s   13901.1  
PI (pH):   %s   5.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAQVSTQQRSSDHGEVLSVHSLDKWNTQFQNSKTSNKLMVIDFSAAWCGPCKFIEPAVHDLAVEFTDVDFIKIDIDELPDVAKDFDVQAMPTFVLLKKGKERDRLVGVKKDELHRLIEKHRF*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCCCAAGTTTCAACACAACAAAGATCATCAGATCATGGCGAAGTCCTTTCAGTTCATTCCTTAGATAAGTGGAACACGCAGTTTCAGAACTCCAAAACATCCAACAAACTCGTA
AGAAACGATCGTATACATCATGTTATTTGATTCTAATAGGTCGTATACCACGTCGTTTTAGTCATGCAATTGAGAAAACCGATTCTTCCAACACTTTCCTTATATTTTCCGTTTTACTAA
CGCTTGCATGATAATACATAGATGGTAATTGATTTCTCGGCAGCATGGTGTGGACCTTGTAAATTCATTGAACCAGCTGTTCATGACCTAGCCGTTGAGTTTACAGACGTTGACTTCATC
AAGATTGATATCGATGAGTTACCC
GTAAGTGTTCTTTATCTGGTTGGGTAACGGGGTCATGTCAAAACAAGTTTCTACTTCTTTCTTGAACGACAAATGCCCATATGACATACACTTGTC
GTCCGATGAGACTTGAACCCACAACAACCACTTACTCGGGCCTCGGCCACTTTGATACCATTATAGGGCTGACAAGTCGTGTCTTAGGGGGGGGGGGGGGGGGGTTCAACAGGTCTCTGG
TGACGCAAACAACAAAAGTTCTAAACATGAATATGACTCGTTTAATTACTTTATATCTAATGTTTATAACACAGTGACAAAAGTCTATTCATATATTCGGATTTTTATTTATTTTTCTTC
TAATTTTGCATAATACGCAACAGGATGTGGCTAAGGATTTTGACGTGCAAGCGATGCCAACGTTCGTATTGCTCAAAAAAGGAAAAGAACGCGACAGGCTTGTCGGGGTTAAGAAGGATG
AGCTTCATAGGTTGATTGAGAAACACAGGTTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCCCAAGTTTCAACACAACAAAGATCATCAGATCATGGCGAAGTCCTTTCAGTTCATTCCTTAGATAAGTGGAACACGCAGTTTCAGAACTCCAAAACATCCAACAAACTCATG
GTAATTGATTTCTCGGCAGCATGGTGTGGACCTTGTAAATTCATTGAACCAGCTGTTCATGACCTAGCCGTTGAGTTTACAGACGTTGACTTCATCAAGATTGATATCGATGAGTTACCC
GATGTGGCTAAGGATTTTGACGTGCAAGCGATGCCAACGTTCGTATTGCTCAAAAAAGGAAAAGAACGCGACAGGCTTGTCGGGGTTAAGAAGGATGAGCTTCATAGGTTGATTGAGAAA
CACAGGTTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTAGTAATAA AACAGATGGT TGAAACTCAT TGGAACAGGA ATCCTATGCC ATGTCAACAT CGATCTAAAA GCTGTTTTCC CACTGCCGAA ATCCAGTTCC GATCGCTATA TATATCCGTA  TGTATATAGA TTTATAACCA GTCTAGAGCA ACTAAAAGTT TATACATTAA AAGATGGGAG CCCAAGTTTC AACACAACAA AGATCATCAG ATCATGGCGA AGTCCTTTCA GTTCATTCCT  TAGATAAGTG GAACACGCAG TTTCAGAACT CCAAAACATC CAACAAACTC ATGGTAATTG ATTTCTCGGC AGCATGGTGT GGACCTTGTA AATTCATTGA ACCAGCTGTT CATGACCTAG  CCGTTGAGTT TACAGACGTT GACTTCATCA AGATTGATAT CGATGAGTTA CCCGATGTGG CTAAGGATTT TGACGTGCAA GCGATGCCAA CGTTCGTATT GCTCAAAAAA GGAAAAGAAC  GCGACAGGCT TGTCGGGGTT AAGAAGGATG AGCTTCATAG GTTGATTGAG AAACACAGGT TTTAAAGAAC CAGTTATAAG CTAGTTACAC GACACAACAC AACACGATTG CAACTTAAAT  AAAGTATATG TAGCAAGTAT GTTTGTTATG TCTTATGTCA CGAGTCCATG TATTCTATAA ATCGCGAGTC GAGAATAATA TGATACCCAT AAGTTCAAAA ACACATATTT ATTTACTATG 
CACAAATCTT C 

Retrieve as FASTA