Entry information : HaTrxH04 (HanXRQChr09g0269471)
Entry ID 14500
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH04 (HanXRQChr09g0269471)
Name (synonym) HaTrxH04 (HanXRQChr09g0269471)
Class Thioredoxin Type H    [Orthogroup: TrxH002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH04
start..stop
S start..stop
HaTrxH08 199 3e-68 1..113 1..113
AtTrxH01 146 3e-47 2..111 3..112
HaTrxH09 144 3e-46 1..118 1..116
ThasTrxH01 143 5e-46 2..111 3..112
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 185989434..185989520 87 N° 2 185989735..185989857 123 N° 3 185990163..185990318 156  
join(185989434..185989520,185989735..185989857,185990163..185990318)


exon

Literature and cross-references HaTrxH04 (HanXRQChr09g0269471)
DNA ref. HanXRQ genome:   HanXRQChr09 (185989434..185990318)
Protein sequence: HaTrxH04 (HanXRQChr09g0269471)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   121
PWM (Da):   %s   13112.65  
PI (pH):   %s   5.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEEGIVVGCHNADQWKEHFDKHKASQKLVVVDFTASWCGPCRVIAPILADYAKKFPHVAFLKVDVDEVESVAQEYSVEAMPTFLFFKNGVKVDTVVGAKKDELLACIVKHAGEAAATVSA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAGGAATTGTTGTCGGTTGCCACAACGCTGATCAATGGAAAGAGCATTTTGATAAGCACAAGGCTTCTCAGAAATTGGTATTCTTTTTTCTTGAATTCTAGGGTTTCCGA
TTTGAATTTTCAAAATTCGCATTCAATTTCGTAAAATTTTCGTTAATTCAATGTTGTTTATTGCTCGTACGGTTTTCCGACTGTTTAATTCGTTAATTTTACGGTTTGGAGGGCCCGATA
GCTCAATTAGGGTTTGTTTTTTTTTTTTTGTTTTTGAAATTATACGTCGTATGATTGACAGGTTGTTGTGGATTTCACTGCTTCATGGTGCGGTCCTTGCCGTGTAATTGCACCGATCTT
GGCTGATTATGCTAAAAAGTTTCCTCATGTCGCCTTCTTGAAGGTCGATGTCGATGAAGTTGAG
GTAAATATTTGCATTTGAATGATGGTGATGATGATGTGCTTCTTTATTACTATTTA
AAATTCGCTTTACATATGGAAAATGTTACTGTTCATTTCATCTTTATGAAAGCGGTTGATAATGATAAAGGTATTTAATTGAAACTAGAAAAACTATGTATTGATTTTTATGTAATTATA
AGATTGAGGCCAGGAAAAGGGATGTAAAATAATAAAAAAAAAACTTTAGTTGTATGTTTCATAATTGTATGTATGGTAATATGGATCTTTGAACTTGGAGTTGATGAATTGATTGGTGTT
TGTATGCAGAGTGTTGCTCAGGAGTATTCAGTGGAAGCGATGCCGACGTTCTTGTTCTTCAAGAACGGTGTGAAGGTGGACACAGTTGTTGGTGCTAAGAAGGATGAACTTCTTGCCTGC
ATTGTGAAGCATGCTGGAGAGGCTGCTGCAACTGTATCTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAGGAATTGTTGTCGGTTGCCACAACGCTGATCAATGGAAAGAGCATTTTGATAAGCACAAGGCTTCTCAGAAATTGGTTGTTGTGGATTTCACTGCTTCATGGTGCGGT
CCTTGCCGTGTAATTGCACCGATCTTGGCTGATTATGCTAAAAAGTTTCCTCATGTCGCCTTCTTGAAGGTCGATGTCGATGAAGTTGAG
AGTGTTGCTCAGGAGTATTCAGTGGAAGCG
ATGCCGACGTTCTTGTTCTTCAAGAACGGTGTGAAGGTGGACACAGTTGTTGGTGCTAAGAAGGATGAACTTCTTGCCTGCATTGTGAAGCATGCTGGAGAGGCTGCTGCAACTGTATCT
GCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAAAGCATC GTATTTTGAT GAAAAGATAA TCTAGAATAA TCCTTCGTTT CACATTTGCA GGTCATTTCC GTAATTATAA ACACGCTTAG GGGCATTTAC GTAATATCAT CCACCGATGA  AAGAGCATAG CCCTATAAAT TGAGGGGTTG GGTGCAGGAC AATCTTCATA CTCAAGAAAT TAAATTTGCA AGCTAAAAAA TTCAAATTAG GGTTTTCTGA AAGATCAATT TGGGGGAAAT  GGCTGAAGAA GGAATTGTTG TCGGTTGCCA CAACGCTGAT CAATGGAAAG AGCATTTTGA TAAGCACAAG GCTTCTCAGA AATTGGTTGT TGTGGATTTC ACTGCTTCAT GGTGCGGTCC  TTGCCGTGTA ATTGCACCGA TCTTGGCTGA TTATGCTAAA AAGTTTCCTC ATGTCGCCTT CTTGAAGGTC GATGTCGATG AAGTTGAGAG TGTTGCTCAG GAGTATTCAG TGGAAGCGAT  GCCGACGTTC TTGTTCTTCA AGAACGGTGT GAAGGTGGAC ACAGTTGTTG GTGCTAAGAA GGATGAACTT CTTGCCTGCA TTGTGAAGCA TGCTGGAGAG GCTGCTGCAA CTGTATCTGC  TTAGATATGT TATGATGATG ATGATGTATC AGCAACTTGT TTGAATCTTT TGTTAAGGAA TATTGGCTGT GTAATCTTGG TTTTATGACT TTGTGGTTTT ATCTATTATG CATAAATTAA  AGTTGCTGTA GTTTGGTTGG TTGGTTTGTT TTCTGTTCAT ATTTTGATTT ATTTGGCATT TGGATAGGAT TAGTTTTACT ATGCTATGAA TAGGAATATT AGACCATCAA GTGGGTCACA  TAATATAAAG GAATTGACAT AAAAAGATAT CACTTATACT GTTTGATGTC TCTATTTGAT GTCGCTATGT ACAATTACTT AACTCGTTAT ATTGATGCTT CTTTAGTAAG TAAAAAGGAA 
GATAATT 

Retrieve as FASTA