Entry information : HaTrxH05 (HanXRQChr11g0345311)
Entry ID 14501
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH05 (HanXRQChr11g0345311)
Name (synonym) HaTrxH05 (HanXRQChr11g0345311)
Class Thioredoxin Type H    [Orthogroup: TrxH001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH05
start..stop
S start..stop
HaTrxH01 204 2e-69 1..134 1..135
HaTrxH06 186 2e-62 1..135 1..136
ThasTrxH09-1 183 5e-61 1..138 1..138
AtTrxH09 178 3e-59 1..132 1..132
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 137891296..137891316 21 N° 2 137892227..137892346 120 N° 3 137893479..137893601 123 N° 4 137893692..137893847 156
join(137891296..137891316,137892227..137892346,137893479..137893601,137893692..1 37893847)


exon

Literature and cross-references HaTrxH05 (HanXRQChr11g0345311)
DNA ref. HanXRQ genome:   HanXRQChr11 (137891296..137893847)
Protein sequence: HaTrxH05 (HanXRQChr11g0345311)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   139
PWM (Da):   %s   15211.66  
PI (pH):   %s   4.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLCFSSTTADEAPANHPHFTGGKVTFITNKDVWNQKLSEAKTQGKIVIANFSASWCGPCKSIAPLYIELSEKHLSLMFLTIDVDELTELSTQWDVKATPTFFFLRDGQQIDKIVGANKAELQEKLSTIVDSQVPGDQK*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACTTTGCTTCTCTTCGGTGAGTTGTCCTTTAATTTACAGACATTTGTATCTACATAGGCTGCTATGTTAAATTAGAAAAAAAAATATTGTATGGTAGGAGGTTAGTCATCTATGA
TTTGCTTCGACGATGCATGCGTTTTTGCTATCAAATACTGTTGCAGAAAATCAAATGTGATGGGTGGTACAGGGTTATCTTCTTTGTGTTTAGGGTTTATAATTTATGCTTTTCGAATGA
TTCTTGATTGCTTTTCCATGGTAGCGGTGGTAAAATGGGTGGATTAGCAAATGATTCAAAATGGGTTCAGGTCAAAACACGTAGGTTTTTCTATCATGAGTCAGGTCGGGTTGACCCGCA
CACTTCTTTGGTGATCCAGTGTCTTAAATTTGTACGAATAGTCAATGTGCCAAAATATGATTAATCAACCATATTGTTATAATCTAGGGGGTCTATGCATTAAAATAATGCACTTTGGGC
ATCCATTTGAAGCATAAGTATTTCCTTCCTAGCTAATAATACATACATTCATCCATTTGAGTCAAAACCTATCCTAAATTGACATAAACTGTTTGCAGATCCTTTTCATTACCAAGTTGT
TTTGGACATCTTTTTGGTATGTCCAAGTTAAAAACTTAAATAATTGTAAGTTACCTCACAACGATGATGTGCTGCTGCGTGTTCTTTCATCATGTTAATATGTTATGTTGAGTTATAAGT
GTATATTAGTTGACAAACTATTCATTTCAAGTCACAAAAAAGGTAGAAATATTCTTTACATTGGTAGAATGGGTTAAACAAGTCAAAAGCCTCTAAATGTGTTTTCAAATGCTTACATAA
AGTATATTGTGTGAGAAGGGGAAGGGATGAAATAAAATCGTAAAAGTACAACCTTAATTTTTGGATTGACCATTGGATTTGATGCTTGTAGACTACGGCGGATGAAGCACCTGCCAATCA
TCCTCATTTTACGGGAGGTAAAGTCACCTTCATCACTAACAAGGATGTTTGGAACCAAAAGCTCTCAGAAGCAAAGACTCAAGGCAAAATA
GTAAGTCATCAAACTTATTTAACATACTC
TTGCATTTTCTATATCGTATCTAGAATTATGTACATTCAATGTAGAATCAGTTTTAAGTAGAGTACTTAGGGAACCACATAGGAACTCGTACTTACTTCTTGTCCAGTGCCGGCTCAAGC
CCAAGCCAAATAAGGCAACTGCTTTGGGCCACAAAATTTTTGAGGCCCCATATTTTACAGGCTTGACTTTAGGTTAAACCCATTTTTTTTTTCATTTGGCATTCATGATGATTGAAGTCT
TGCAAATTCCCGTAAGTTTCCATTAATTCATTGCATGTTCCCATGAGAGAAATAATTGATTTTACTAATAGAACATGTAATTCCAAATTGTGAAGAAGATAAATATATAAATCGTGAGGT
TTGTTTTGTTTTTTTTTCTTTATCCTATTTGTGAAGCCGGTTCATATCCCCATAAGTGATAAATAGTAATGCAATAACCGCGTTATGTGGTTACATAACCGCGTTATATGTCATAGTTAA
TGCAATAGGTACATGTGTTTAGGAGGTTTCAAGTGTTAACATATGTGTGTGTAGGGAGGGGATCATTTCAGAACACACAATTTTTTGCAAGAACACGCATAACAAATTTAAACAGTTTAG
TTTTTAACAAGTTATTTATCTTTATAAATATTTGTACTTCTAGTTTTTAATAAGTTATTTATCTTTATAAATATCTGTACTTCTTGAGTAGGTTATGTACATAAAAAGTCATCAAAGTAT
GTGTAGGTTACATTACCTAGTATACATGAGATCCCAAACATATTTGCAGGGCCGGCCAATCCGTGCCGTCGCTCGAGGCCCAAATTTTTAAAGGGCCCGAAAAGTTTTTATAAGCTTCTA
TAGATATAGTAAATTATGTATTTAATATACGCATTCATTTATTGTAATTAAAATTGTTGGTGGTGGAGTGGAAAAAACCATCTCAAGTTATTGTAAAGGTCTCAAGTTCAATACTTTGCT
CCACCACAAATGTCTATTTTTTTAAATTCATTTCCCCTTACCACAATTTTGGGCCCAAATTTTTATTTTGCCCGAGGCCTAAATTATTTAGAGAGTTTTCTACGTTTTGATATATTGATT
ATATTACTTTGTACGATTAACAGGTTATTGCTAACTTTAGTGCATCTTGGTGTGGTCCATGCAAATCAATTGCACCATTATACATTGAGCTTTCCGAGAAGCATCTTTCTCTTATGTTTC
TGACCATAGACGTTGATGAATTAACG
GTAATTAAGTTACACCATTTGTTTTAAAATTATGTCGCCCTTTAGGTTTCCGATAATTGTAGCGAAAGTTAGATGTAAGTTTTGATGCAGGAGT
TAAGCACACAATGGGATGTAAAAGCTACTCCAACATTCTTCTTCCTTAGAGATGGGCAGCAAATTGATAAAATCGTGGGAGCCAACAAGGCTGAGCTGCAGGAAAAATTATCCACCATAG
TCGATTCACAAGTCCCAGGTGATCAAAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACTTTGCTTCTCTTCGACTACGGCGGATGAAGCACCTGCCAATCATCCTCATTTTACGGGAGGTAAAGTCACCTTCATCACTAACAAGGATGTTTGGAACCAAAAGCTCTCAGAA
GCAAAGACTCAAGGCAAAATA
GTTATTGCTAACTTTAGTGCATCTTGGTGTGGTCCATGCAAATCAATTGCACCATTATACATTGAGCTTTCCGAGAAGCATCTTTCTCTTATGTTTCTG
ACCATAGACGTTGATGAATTAACG
GAGTTAAGCACACAATGGGATGTAAAAGCTACTCCAACATTCTTCTTCCTTAGAGATGGGCAGCAAATTGATAAAATCGTGGGAGCCAACAAGGCT
GAGCTGCAGGAAAAATTATCCACCATAGTCGATTCACAAGTCCCAGGTGATCAAAAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTCTGTTC CCTCTTAAAA TTTCCACATG GCACCTTCTA AAACAAATTC GATATGAATA TTCGTAACAA GAAAAAGGTG ACCAAAATTT CAAAATTAGG TCTGTACGAT ATACCCTAAT  TAGGTTACGA TTTGTGATTT TGCAGGAGCA ACACATTTCA ATCGTTGCCT GAAATAGGGT AAACCCACTG CAGTTACTTT TTGAAACCTC TAAATGGGAC TTTGCTTCTC TTCGACTACG  GCGGATGAAG CACCTGCCAA TCATCCTCAT TTTACGGGAG GTAAAGTCAC CTTCATCACT AACAAGGATG TTTGGAACCA AAAGCTCTCA GAAGCAAAGA CTCAAGGCAA AATAGTTATT  GCTAACTTTA GTGCATCTTG GTGTGGTCCA TGCAAATCAA TTGCACCATT ATACATTGAG CTTTCCGAGA AGCATCTTTC TCTTATGTTT CTGACCATAG ACGTTGATGA ATTAACGGAG  TTAAGCACAC AATGGGATGT AAAAGCTACT CCAACATTCT TCTTCCTTAG AGATGGGCAG CAAATTGATA AAATCGTGGG AGCCAACAAG GCTGAGCTGC AGGAAAAATT ATCCACCATA  GTCGATTCAC AAGTCCCAGG TGATCAAAAG TAACCATAAT CTGGTCAATG GAATACAAAG AGTCTTAATC ATTTTTTGTT TGTTTTATGG TATTCTTATA AATGACTTAT GTTTCATGGT 
ATTGGTTGAT GGTACATACA TGTCAATATA TTAATTTGTT CACTTCATTC TCAAATGTTG AGTATTTAGC TAG 

Retrieve as FASTA