Entry information : HaTrxH06(HanXRQChr12g0367921)
Entry ID 14502
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-12-07 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-07 (Catherine )
Peroxidase information: HaTrxH06(HanXRQChr12g0367921)
Name HaTrxH06(HanXRQChr12g0367921)
Class Thioredoxin Type H    [Orthogroup: TrxH001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH06
start..stop
S start..stop
HaTrxH01 196 4e-66 1..139 1..139
AtTrxH09 194 3e-65 1..138 1..137
ThasTrxH09-1 193 6e-65 1..138 1..137
ThasTrxH09-2 194 5e-64 1..136 100..234
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49565934..49565954 21 N° 2 49562494..49562616 123 N° 3 49562280..49562402 123 N° 4 49560302..49560469 168
complement(join(49560302..49560469,49562280..49562402,49562494..49562616,4956593 4..49565954))


exon

Literature and cross-references HaTrxH06(HanXRQChr12g0367921)
DNA ref. HanXRQ genome:   HanXRQChr12 (49562616..49560302)
Protein sequence: HaTrxH06(HanXRQChr12g0367921)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   144
PWM (Da):   %s   15899.78  
PI (pH):   %s   4.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVCLSKYHDDDDESNHQAEFAGGNVTLVTTKDAWDQKLSEANREHKIVIANFSASWCGPCRMIAPYFIELSLNHTTLMFLSVDVDELPEFSTQWDIKATPTFIFLRDGDQVDRLVGANKPELLKKISGIVNSQPPPPPACSDM*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTATGCTTGTCTAAGGTGAGTTTTCAATTACTTACTAGTAAAACGATTCCATTTTATTATCATTTCAATTACTGAACCTGTCTCATTTTGTGGAGATAAAGAATATTTTTATCA
TGATAAGAATACATAGTCGTGGGAAAACATGGATAGTCGGAATTGAACGACTCGGGCATTATAGAGTGAGATTGCATTGCATGATCACCATCATGAATGATATTTATTGAAATTAGATTA
AGTGTTTTCTTTAAGGCTTACAGCCTTCCTATCCCGACAGATGGTGTTTTTAATCCTTAATAATATGTGCATGCTCCAACTGTCCCATCATGTGGGTGTTAGGCGTAACATAAATGTATC
TTTAGAATTTCGAGACATCGATTGTCTCTCCCAATGGGTAAACAAAAACTAAATCAGTTTGGTGCTGTTTGTTTTTTCTGTGGGAAAAGGTCTGCAGTCTGCGGACCACATCTGCAGGCA
TCTGCAGGAGAAAAGGTGGACCAAATGTCTGCAGTCTGCAAGGAAGAGAGGGTTTGTTTTTTTTTATTTTATAAAAACATCTTCTCTTCTCAAACACACACAAACACACTTTCACACACA
CACACACATCCCTCGATCTCTCTCCTCTCTGCCTTCATCACCACCACCAAGCACCACCGTCACCACCGCCACCACCGTCACCACCGCCACCACCGTCACCACAAACCTCCCCCGTCGCAA
CCACCCACCCCCGTCACACTCTCCTCCCTCGATCTCTCTCTCTGCCTTCATCACCACCGTCACCACCGTCACCACCGTTCTCCGATGATGATGATAATGGTCTCCTGCTGCTCCCCTCTC
TCTCTCTCTCTCTAGTCTCTACGGTATCTCTCTCTCATCGATTTGGGGGTTTGTTCGATTTAGGGTTTTGGTTCGATTCAGGGTCGGAGCAGGGGTTCGATTTGGGGGTTTTGATGATGA
TGATTTGGGGGTTTTGATGATGATGATTTGGGGTTCGAATTGATGATTTGGGGGTTCGATTTGGGGTCGGAGCAAGGGTTCGATTTGGGGGTTTTGATGATGATGATAACAGATGATGAT
GATGATGATGGTGTCGGAGCAGGGGTGTCGGAGGTGGAGTTGGTGGCGGAGTGGAGGTGGTGGCGGAGCAGTGGTGTCGGAGGTGGAGGTGGTGCCAAGAAGAGGTAAACGTTTGCGAGG
AGAAGACTTGGGTCCATGTCTGCTCCAAGAAGAGGTCTCGCAGACCTTTTTTAATGAAAGGTCTGCGAGAAAACAAACAAGCTGCAGACATCAAACGTCTGCGCGCGTCTGCGTCGCGCA
GACATAAGTGGCCAGAAGTACTTCTGGCCAAAAAACAAACAACACCTTTATCATTAAGCATAAAAATAAATTACAGTTGTAAAGCCCTTTGCATATAGACTGACGAAAATCCATATCCTA
ATATAACTAAAACATTGCTCCTAAATAATAAAATACATGTATCTTATATTAATCATCGTAAACGATTGGGGATTATTGTAGCTGTCCCAAAAATTAGAGTTACGATTCCGGATGCTGTTT
AAGCTGATGCACCACTAGTGTCATTGATCCTTGAACCAAGACTCCAACCGGTGGAGGTTTGGGTCTATTTTTTGATGGAAGATTTTGCTTATTTGGTAGCCATTTGTGACGATGATCCAT
TAAGCCCTAGGTGGTTCAAACTTGGTTGTTTTTATAGCTGGAATTATGGCAAAATTTACATATTTATTTTGATTACGAGGGTTAGGGTTGATTTCGGGCTCGATAGATAAAGGGTTTTAG
GCTGTAGGCGAGTTAGTGGGTGGTGTATATGAATCATTTAGTCGGGTCAATACTTTAGTCAATTTATAATCTGGGCCATTCTTGACGATGGCAGTTGCTGTCGGTGTTTGACGAGGAAGT
TCTGCCATGCTGATGATGGTGGCTACCGACATGCCTGACGAGTGACGATGGTGTTTGTTGGCAATGTTTTCGGCTTATATGTCTAATTACAAATTGAGTCTATCTAAGGTTTATTTTTAA
GAAAAAAGTAAATAAATATTTGAAATTAACTTTTATATTCAAATATACATATATAATAAGTGAGTTTGTTCATCTGTTTAGATTGTTTGGGTTGTGGGTCAGATCAAAATCCAGTAACTA
ATGGGTCAGATCAGGCTTCCTTTAGTCGGGTCATGGGTCAGGGTCAGATCATATAATCAACTACTAAGCTTAACTACTTCCTAGACCAAGAACACACCTGACTATGTATCTTCTAAATCA
CACACATCCTAGTATCCTATTTCAAGTACAGTGAGAGAACAACTACTACCTCTACAACAATTGGATGTCTGATATCTAGTTCTGTCGGTAACCAATCATATCGGTTACATTTTTCTTGAA
TGGAGAAGCTGTAAACCTCTGTTCGATTTGGTTACACATAAACCAATAATATGTATTTTATTGATGAATACATGTCCAGGAATTGATTATACAAAGTAATTAACTAAAGCAAATACTTTC
TGACCTAATTTAGTTATCCAAATCCTAAAACATTGTACATATAAGTAGAAAATATATAAAACTAGATACAGTTTTAGATAACAAGAATCAAACTTTTAGTTCTCCGTTTTTTTTTTATTT
ATTCAAGAGCTTCCTTTATATCATAAAGAGAGGCTAAAAAAGAAAGGATACTATAATTTTTTTTTTCTTTTTTTGTAAATAGACTGAAATTGAGGACCGATATTATCGGTGATATATCGG
TCCCTTAGTAAAATATCAGCGTCAAATATCGGTACCGATATTATCGGCGATATTGACCGATATAACCCATATATCGCCTATATTTGACCGATATATCACCGATATTTGACCGATATAACA
GATATATCACTGAATTATTGGTGTTAAATTGCTACATATATAAATTCTGCATTATATTAAGATTACCGATATCTCACCGAGATAACCTATATTTCAAATATCGGTGGTCCTTGACCGATA
TCCGATATTTTACCGCATTAACTGCATAGCCTAAAGCAACCCAGCTATAGGTGCTACCTAAGAAGCTATATGTACAACCTAAAGAATCCACAACTGCTCATTCTATTTCACTTGAGAATC
AAAATATATACTACTTCTATGTTACACACAGTCAACCAAGTTCCTGAATATTCACATCTACCAAATAAGTAAGAGTCTTATGGTAAAATAAGCTTAGAAGTTGATGAACATGACCGTCAA
AGCTGGTGATCAACTTTGACTGTTAGCCTAAAATTCATCTTTTTTTTTGTTGTTGTAAATTAACCGACGATGTAGTTTAATGCAACTAATGTTTACAGTATCATGACGACGATGATGAGT
CGAACCATCAGGCTGAATTTGCTGGAGGTAATGTGACACTTGTCACTACTAAGGATGCTTGGGATCAAAAGCTATCAGAAGCAAATAGGGAACACAAAATA
GTACATTTTAATATTATAT
GAATTACATAATTTACCTTTCTTGCTATATTATAAAGTAGTGTCTCATGATATATGTTTGTCTGGGTTCCAGGTAATTGCCAACTTCAGTGCATCCTGGTGCGGGCCATGTAGAATGATC
GCACCATACTTCATCGAGCTTTCTCTGAATCACACTACTCTTATGTTTCTATCAGTGGACGTTGATGAATTACCA
GTAAGTTATATATCCTCCTTCTTGGTAATTTGAATTTCACATGTC
AATTTTATAACTGAATTATGAATGTTTTAACATCCTAAAACTAGTTGTTAGATTTTTTTTTTGAACAGCGAAACTTCTATAAAAATATAGAAAAAGGGCCAGCAAGAAACTAGAATCCCA
AAGTTACAAAATTATATCCTGGATATTAAAGTCACACCATCTAACCCAAACAAGGCTTACGTATTTAGATCTACTAGAAATCCAATAAAAAGCGTTTTCCTTGATAGTGTCCGCCATTTT
ATTAAACTAATTGTTAGATGCAAAGGTACTTTGAGTACAGCAATGCAATATCTTTTCTAAATTGTCCATAATTAATATGTTAGGCTATAGGGTGTGAGGGGCATGGTTGGGTCATCAATC
GTCACGTAGGATCATTAATGGATTGCTACACCACCCCCTTGTCTCATCCACCATGATTCCCATGGATTAAACCATGACAACCATGAGCCTCCTTTCCTTATTCAATATCTCCTTTCCTTT
TCACAAAAATAAATTGAAATAAGATAATAGTGGTTTGAGTCATGACCACACCCTTAGGGTAGTGGTTTTGGATGATCGATTAGAAGCAGGTGACATGATGCTAATGTGGAGGGTCATGGT
GATCATGAGGGTCATGACCACACCCTATAGCCTTACTTTAATAGGGTAACTCTAGAGAAATGTAGCCATGTTTGGCAAGTGTTCTAAATTAAGTCATTAAAGCTTTTTTTTTTGTCTCTT
TAAAGTCACTAAACTTTAATTTAATGTTCTAATCCCATGTAATTATCAGGTTACCAGGTAACAATGATGATTTGTCAGGTTTCATTATTTTTTTAATTATTAAAATGATTAGGAAAAAAA
TATCGCTTCATTCTCAAATACTGAAAATAAATGGCAAGATTTAGTGGATTGTTTTTTTAATCATAAAATTTATTTACTTATCCTCTTAACAAGCTTCTTCTTCATCCTACTTACACAGTG
GAAGAACACCATGGCTAAACTAAGTTCTTCTCTCCCTTTTTGTTTTATAGATTTTTTTACTTCATATTAATTTCCCACCTTATTCATCCTACGTTACATTTTACAAAAATGAAAGAACTG
GTTTTGTTGTCAAGCCAGTGCCACCGTCAACCACCGTATTCCGCCACCACCGGGGACGGTTCTTCCACCACAAAGTTTAAAAAACTCTCTCTCCTCGACTGGACTTCTACCGATGACGCC
CGATTCCGGCGAGGATCTGTTTTAAAGCCGACGATGGTGGCTGCGGTACGTAGCGGAGGAGATGAGTATTTCTGCACTTACGTTCAGAACTGGATTTCGGCTAGAAAGGTTGATTACAAG
CTTATCAGCGCCGGGGTTGTCGGGCGGCGTGCGGTTGTTTGCAGGTGTCGGGCGAAAGGCGTCGAGTCTCATGTCTTCAATATCAAAGAACAAGTCTCATGTGTTTCAAAAAAACACCCA
CAGAGTACACGTACATCTAAAAAATATATTTTATCTTTTTATTATCATTATTATTATTAAACAAAAATAAATGATAACCTGATAACCTGGTAATTTACACACTGTTAGAACATAAATTTA
AAGTTTAATTACTTTAGAGAAACAAAAAAAGTTTGAATGATTTAATCAAAACACTTGACAAACTTGATTACATTTTTGTGGCATTTTCCCTACTTTAATTACATATATTCTAATTGTTAA
AATTTTGTTAAACTTTATTTCTTTATAGGAGTTTGTTAAATTTTGATTTATAGAAAGATATTTTTTTTTCCGGGTGTTAATGCAGGAATTCAGCACACAATGGGATATAAAAGCGACTCC
AACGTTCATATTCCTTAGAGACGGAGACCAGGTTGATAGGCTTGTGGGAGCCAACAAACCGGAGCTCCTAAAAAAGATAAGCGGTATTGTCAATTCCCAGCCTCCTCCTCCTCCTGCTTG
TTCTGACATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTATGCTTGTCTAAGTATCATGACGACGATGATGAGTCGAACCATCAGGCTGAATTTGCTGGAGGTAATGTGACACTTGTCACTACTAAGGATGCTTGGGATCAAAAGCTATCA
GAAGCAAATAGGGAACACAAAATA
GTAATTGCCAACTTCAGTGCATCCTGGTGCGGGCCATGTAGAATGATCGCACCATACTTCATCGAGCTTTCTCTGAATCACACTACTCTTATGTTT
CTATCAGTGGACGTTGATGAATTACCA
GAATTCAGCACACAATGGGATATAAAAGCGACTCCAACGTTCATATTCCTTAGAGACGGAGACCAGGTTGATAGGCTTGTGGGAGCCAACAAA
CCGGAGCTCCTAAAAAAGATAAGCGGTATTGTCAATTCCCAGCCTCCTCCTCCTCCTGCTTGTTCTGACATGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTAAAGGACG AAAGGTGCAA TGGATAAATA CGTTTCCCTA TCTAAGAAAG AAAATCTTAA AAAAAAAAAA AGAATTGGTG GCGATATCTT GTGCTCCTCT GCAACTACAG GTTTATGCTT  ATGAATGATA GATTGAGGTG TTAGCTGAAT AAGGGAAGTT CAGCTCTTCA ACCGTCTCGG ACAACCTAGC TTTTCAGCGG AGTAGAGTGG AAGTTTTTCA TACATCAGAT CAGGATGGGA  GTATGCTTGT CTAAGTATCA TGACGACGAT GATGAGTCGA ACCATCAGGC TGAATTTGCT GGAGGTAATG TGACACTTGT CACTACTAAG GATGCTTGGG ATCAAAAGCT ATCAGAAGCA  AATAGGGAAC ACAAAATAGT AATTGCCAAC TTCAGTGCAT CCTGGTGCGG GCCATGTAGA ATGATCGCAC CATACTTCAT CGAGCTTTCT CTGAATCACA CTACTCTTAT GTTTCTATCA  GTGGACGTTG ATGAATTACC AGAATTCAGC ACACAATGGG ATATAAAAGC GACTCCAACG TTCATATTCC TTAGAGACGG AGACCAGGTT GATAGGCTTG TGGGAGCCAA CAAACCGGAG  CTCCTAAAAA AGATAAGCGG TATTGTCAAT TCCCAGCCTC CTCCTCCTCC TGCTTGTTCT GACATGTAAT GCAACCGTAT ATAACTTTCC CTATGGTGTT TATGTATTTT CGTAACAATC  GTTATGAATA TGAATGTTGA CATTGTATTG TTAGGTTGGT ATTTCTAAAA GAAACTTATA GATCACATAC ATGCTTAGGC CCCTCTATGG CCTAGAAAGC TAACATAGAC TCTAAAATGT 
TTTAACCACA CATGAGAATT TGTTTTTTTC TCCTTCTAGA AATATAAAAG TTTTATAAAA AATTATGCAT ACGATAAATA ATAGTATATG TATGTGTATA TATAAC 

Retrieve as FASTA