Entry information : HaTrxH08 (HanXRQChr16g0501431)
Entry ID 14504
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH08 (HanXRQChr16g0501431)
Name (synonym) HaTrxH08 (HanXRQChr16g0501431)
Class Thioredoxin Type H    [Orthogroup: TrxH002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH08
start..stop
S start..stop
HaTrxH04 209 7e-72 1..121 1..121
AtTrxH01 157 3e-51 2..111 3..112
HaTrxH09 154 5e-50 1..119 1..117
AtTrxH04 152 1e-49 2..117 3..119
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13984764..13984850 87 N° 2 13986560..13986682 123 N° 3 13986781..13986936 156  
join(13984764..13984850,13986560..13986682,13986781..13986936)


exon

Literature and cross-references HaTrxH08 (HanXRQChr16g0501431)
DNA ref. HanXRQ genome:   HanXRQChr16 (13984764..13986936)
Protein sequence: HaTrxH08 (HanXRQChr16g0501431)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   121
PWM (Da):   %s   13005.53  
PI (pH):   %s   5.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEEGVVIGCHNVDQWNEQIGKHKASQKLAVVDFTASWCGPCRVIAPILADFAKKMPHVTFLKVDVDEVETVAQEYSVEAMPTFLFFKNGEVVDKVVGARKDDLHACIVKHSGAAAATASA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAGGAGTTGTGATCGGCTGCCATAACGTTGACCAGTGGAATGAGCAGATCGGAAAGCACAAGGCTTCTCAGAAACTGGTATAAACCCTAATTTCCTTTTTTCTATTCTTC
TCAGAAACTGGTATAAACCCTAATTTCCTTTTTTCTATTCATTTCTGTAGAAATTGTTATTGTTTTTTAATTTAATAATTTTTAATAGGGATTCACATGTTACGCAATTAAATGATTCTA
CCGATCGTTAATTGATTCTTTTCATTATTCTTGTTTGTATTGACTGAATTTAGGGATTAGGGTTTAGGGTTGACCTATTTTGATTGAGAGTTATGTTGAATTAGACTTTTATTTTTGAGT
ATTGTAAATACATATCTTGAGTAAATTACTTTTTTTAGTCTGTGTTTTAGTGGTTTTAATCCATTGAGTCCAAAATCAAAAAGCTTAACGCCCTGTGTCGTTTCTAACTGTTCTTTTTAT
AACGTTTTGAGTCCAACCTTTTTACAATTGTAACTACTAAAAACACAGAGACCCAAAACGTTATAAAATGAGCGGTTAGCTATGTAGCACGGGGATTCCATTTATGTGGCCGTACCCGTC
TCGGGTACTTGTCGGGGACGGAAACACCATGGGTACTCGTCGGGGACGTTTCCTAAACGTTTCCAATGTCGGGGACGTATCTGGTAGAAGTATCCAGCTCGTTTCCATTTGCTTTTTAGG
GTTTTTACCCTTTCAAATTCCTCAACCGGCCATTAAACAAATAGACCTATCATATTTGGTTTCTCTAATCTCTAAACTCTCAAGTCTCATCATCTCTAATTCTCTATTGATTGCCGGTCT
CTCACTAGATGAACCGGAATTTGAAAATGATTTGATTATTGATAATTAATTACCTTTGGAAGATGTAGTATTTTTGGAATTTGTTTAATGTATTTTTATATTTTTTATTGCCGTACCCGT
ATATTGGAATTTTGAGTTTTGCCGTTCCTCGTTCCCGTATCGTCCCCGTACCCCGATCCTGTACCCGTTCCAGTGCTACTTAGGCGGTTAGGGACTCGGGGCGTTAAACTTTTTGGTTTT
GGACTTAGGTGGTTAAAACCACTGAAACACAAGGACTCAAAAAGTAATTTACTCATATATCTTTTAATGAACTGGTATATGAAACTTGTAGGAGATGCAAAAATCGGGTTGAAACCCTAA
ACCGGTTATGGTTGGCCAACAAAAAGTGAAAACTGATTTGGGTTTAGCCGGTTTTAAATGAGAGATCTATAAACTGGTAAGAAACCTACGGGTTGCGCCAGTTGCAAACCAGTGTCTGTG
TATACTTGTTTTAAACTGGTTTCGGTTCTCAAACTGGTTTAGTTGTGCCCCTCGCTGGTTGAGTTCGGTTTTTGTCGATTATTCCATGCTCTAGAATATTGTTTGTATGCATGACCTATT
TGCTGGTTTTGATTTCATAGAAAATTGTATGCCTTGTATGTCTCTGGTGGATGGCAACCCATGCTAAGATACAAGTTTTTTAAAAAATCGGGTCTCGTATCCATTCGTGAAGCTTCAAGA
TTTTAAAATTATAAAGGCATGGTCTATGCGCATATGTAGTCTCTTTTTAAACTGGATCAATTAGTTTTATTACTGATTTCGTAGAATGTAAATCCAATGCAAATTATCTCTTAAAAACCT
TGTAAGATTAGAAGCACAAGGTGTAAGCAAGCATAGTCATGTTATTCATTGTTAATGAATTTCCTATAGAAAGACCGATCTTTGAACAGATACTATTTTTATGAACTTATCGACAGGCGG
TTGTGGATTTCACGGCTTCATGGTGCGGCCCTTGCCGCGTGATTGCACCGATCTTGGCTGATTTCGCCAAAAAGATGCCCCATGTGACCTTCCTCAAGGTTGATGTCGATGAAGTCGAG
G
TAATAGATGAATACTCTTATTCATGTTTTTTTTTTCCTTTCTTTCAGTTTAATGTTTTAAATTCATGAATGGTCAATCTATTTCTGTTTGGTTACAGACTGTTGCTCAAGAGTATTCAGT
GGAGGCAATGCCAACATTCTTGTTCTTTAAGAACGGAGAGGTGGTGGACAAGGTTGTGGGTGCGAGGAAAGATGATCTCCATGCCTGCATTGTTAAGCATTCGGGAGCGGCTGCTGCTAC
TGCATCTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAGGAGTTGTGATCGGCTGCCATAACGTTGACCAGTGGAATGAGCAGATCGGAAAGCACAAGGCTTCTCAGAAACTGGCGGTTGTGGATTTCACGGCTTCATGGTGCGGC
CCTTGCCGCGTGATTGCACCGATCTTGGCTGATTTCGCCAAAAAGATGCCCCATGTGACCTTCCTCAAGGTTGATGTCGATGAAGTCGAG
ACTGTTGCTCAAGAGTATTCAGTGGAGGCA
ATGCCAACATTCTTGTTCTTTAAGAACGGAGAGGTGGTGGACAAGGTTGTGGGTGCGAGGAAAGATGATCTCCATGCCTGCATTGTTAAGCATTCGGGAGCGGCTGCTGCTACTGCATCT
GCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCATACTCA AATTAGATTT TCCAAAAGAT AATTTTTAAG AAAAAAATAT GGCTGAAGAA GGAGTTGTGA TCGGCTGCCA TAACGTTGAC CAGTGGAATG AGCAGATCGG AAAGCACAAG  GCTTCTCAGA AACTGGCGGT TGTGGATTTC ACGGCTTCAT GGTGCGGCCC TTGCCGCGTG ATTGCACCGA TCTTGGCTGA TTTCGCCAAA AAGATGCCCC ATGTGACCTT CCTCAAGGTT  GATGTCGATG AAGTCGAGAC TGTTGCTCAA GAGTATTCAG TGGAGGCAAT GCCAACATTC TTGTTCTTTA AGAACGGAGA GGTGGTGGAC AAGGTTGTGG GTGCGAGGAA AGATGATCTC  CATGCCTGCA TTGTTAAGCA TTCGGGAGCG GCTGCTGCTA CTGCATCTGC TTAGCTTCTG GATCTTTGAT CATCAACTTG TTTTTATCTT CTTTGTTTCT TTGGGGTTAA AACCTTAGGT  CTTGAATATT ATTTATTGTC TTTGTAACCT TGGTTTATAA ATCTGTGTTT GGTGTGAAGT TTCTGCATGT TATATTGTTG CCCTGTTGTG TTGGGTGGAT ATCATTCATG CTCATATAAA 
GGATATGTGA TCATAACAAA TTCACTTCTA TATGCAACTT TATAACTATC TTAACCTCAT TATCATTTTT 

Retrieve as FASTA