Entry information : HaTrxH09 (HanXRQChr16g0530851)
Entry ID 14505
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH09 (HanXRQChr16g0530851)
Name (synonym) HaTrxH09 (HanXRQChr16g0530851)
Class Thioredoxin Type H    [Orthogroup: TrxH002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH09
start..stop
S start..stop
ThasTrxH01 165 9e-55 2..109 3..112
AtTrxH01 154 1e-50 2..109 3..112
HaTrxH08 152 1e-49 1..111 1..113
HaTrxH04 144 2e-46 1..116 1..118
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 177846065..177846145 81 N° 2 177845416..177845538 123 N° 3 177845154..177845303 150  
complement(join(177845154..177845303,177845416..177845538,177846065..177846145))


exon

Literature and cross-references HaTrxH09 (HanXRQChr16g0530851)
DNA ref. HanXRQ genome:   HanXRQChr16 (177846145..177845154)
Protein sequence: HaTrxH09 (HanXRQChr16g0530851)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   117
PWM (Da):   %s   12848.65  
PI (pH):   %s   6.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGEEGQVISCHTVDAWNHHIKKDKNKLIVVDFAASWCGPCKVIAPFVAELAKSMPHVTFLKVDVDELKEIASDWEVEAMPTFLLLKNEKTVAKVVGAKKDELQQTIIKHSGNTSISG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGAAGAAGGACAGGTGATTAGTTGCCACACTGTTGATGCCTGGAATCACCATATCAAAAAGGACAAGAACAAATTGGTATTATGTTGTTCATTTTAACAATCATAATTGAGATTT
TATTCCTTCATCCCTTTTTATTCCAATTCTCCTTCCATTTTTCATTGATTTAAGTTTCGTCGTGTGTATTGGTTTTCTATAATCTATGGTGGTTGATTAAATAGGGTTTTTAGGCTATTG
TTATCGGTACACCACCCCAGTAGTGGACACCAAGCCACATTTCACATCGTATGGGTAGTACGGGCCCATATGGGCCATATTGGTGCTCGAAAAAGGGCTACGGGCCATATGGGTCATATC
ATTGTCATTTCTTTGTCAGGTTGAATATTTAATATGGGTCGTATGATTTGTTCGAAACACCCTCTCATACGGGTCATATGGCTATCTTACCCCTCTCATACCAACCGTATGGACCATATT
CGCCTTGTTATACGGCCCGTATGAGGTATGACATCTAGTTAACATGTGGTGGTGTACCGATATCAGCTACCTTTTTTTAATCACCATTTGTTCCAGTTAGGGGTCTTAACTATTAAAATT
TATACAGATAGTTGTGGACTTTGCTGCATCTTGGTGTGGACCTTGCAAGGTCATTGCTCCATTTGTAGCAGAACTAGCTAAATCAATGCCCCATGTCACCTTCCTCAAAGTTGATGTAGA
TGAGCTAAAG
GTAAAAAAAATAATAATAATAATAAATAAATAAATAATTAAAAAAACATGTTTCTTTGCTTTACATTATATTATATTATTCATTTGACCCTAAAAAGTCAAACCCAATAC
AGGAGATTGCATCAGACTGGGAGGTGGAAGCAATGCCAACATTCTTGTTGCTGAAAAATGAGAAGACTGTTGCAAAGGTTGTAGGGGCAAAAAAGGATGAACTTCAACAGACAATCATTA
AACATTCAGGTAACACAAGCATAAGTGGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGAAGAAGGACAGGTGATTAGTTGCCACACTGTTGATGCCTGGAATCACCATATCAAAAAGGACAAGAACAAATTGATAGTTGTGGACTTTGCTGCATCTTGGTGTGGACCTTGC
AAGGTCATTGCTCCATTTGTAGCAGAACTAGCTAAATCAATGCCCCATGTCACCTTCCTCAAAGTTGATGTAGATGAGCTAAAG
GAGATTGCATCAGACTGGGAGGTGGAAGCAATGCCA
ACATTCTTGTTGCTGAAAAATGAGAAGACTGTTGCAAAGGTTGTAGGGGCAAAAAAGGATGAACTTCAACAGACAATCATTAAACATTCAGGTAACACAAGCATAAGTGGATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACAAAATCA TTAACAAAAC ATAGTAATTT ACGGTTAGAA TTGGGTGGAA ACAAACCAAA ACTCAATCAT TTCCTTGGAA ACCATTTTTT ATTGAGATCA AGAAAATGGG GGAAGAAGGA  CAGGTGATTA GTTGCCACAC TGTTGATGCC TGGAATCACC ATATCAAAAA GGACAAGAAC AAATTGATAG TTGTGGACTT TGCTGCATCT TGGTGTGGAC CTTGCAAGGT CATTGCTCCA  TTTGTAGCAG AACTAGCTAA ATCAATGCCC CATGTCACCT TCCTCAAAGT TGATGTAGAT GAGCTAAAGG AGATTGCATC AGACTGGGAG GTGGAAGCAA TGCCAACATT CTTGTTGCTG  AAAAATGAGA AGACTGTTGC AAAGGTTGTA GGGGCAAAAA AGGATGAACT TCAACAGACA ATCATTAAAC ATTCAGGTAA CACAAGCATA AGTGGATGAA AGCATACACT TTGGGAGGAT  TCGGTTAATT TCAATGTATC GGTTTTTCCA TGTTGATTGA TTGTAATAAG CTGTGTTCGT TAGCACCTCG TTTTATTGGT TGTGAAAGTT AATAAAATCT CCTCCTTCGT CGTTAAAAAA 
AATAAAAGAT AAACACAG 

Retrieve as FASTA