Entry information : HaTrxM01HanXRQChr03g0078551
Entry ID 14506
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM01HanXRQChr03g0078551
Name HaTrxM01HanXRQChr03g0078551
Class Thioredoxin Type M    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM01
start..stop
S start..stop
HaTrxM04 286 3e-100 35..212 1..185
HaTrxM03 280 1e-97 35..212 1..185
HaTrxM06 264 2e-91 35..212 1..163
ThasTrxM04-2 198 3e-65 35..212 1..191
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 120813534..120813858 325 N° 2 120811862..120812175 314  
complement(join(120811862..120812175,120813534..120813858))


exon

Literature and cross-references HaTrxM01HanXRQChr03g0078551
DNA ref. HanXRQ genome:   HanXRQChr03 (120813858..120811862)
Protein sequence: HaTrxM01HanXRQChr03g0078551
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   23047.99  
PI (pH):   %s   9.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCKARDTLPSTQISNPVTETKTTTHTFSIFHFLFMAAVLETLTVPRASAFPAASSSPIVSSARRSFVNLSKSKGFKIQSVSVSGSVSLRSKLGRRGSRIVCQAQEAVQVLPVTDATWQSLVLESDLPVMVEFWAPWCGPCRMIHPVIDELAKEYTGKLTCYKVNTDESPTIASRYGIRSIPTVIIFKDGEKKDAVIGAVPKSTLSTCIEKFF

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAAAGCACGTGACACTCTTCCATCCACCCAAATATCTAATCCTGTGACAGAAACCAAAACCACCACACACACATTCTCCATTTTCCATTTCCTTTTCATGGCTGCTGTGCTTGAA
ACTCTCACAGTTCCCCGTGCCTCCGCCTTTCCGGCGGCATCGTCGTCTCCGATCGTCTCTTCTGCTCGCCGGAGCTTTGTAAATTTGTCGAAATCAAAAGGTTTCAAAATCCAGTCGGTT
TCCGTTTCTGGATCGGTGAGTTTGCGGTCTAAATTAGGTCGCCGTGGATCGCGTATCGTATGTCAGGCTCAAGAAGCTGTTCAAG
GTTAGATTCGTGCTTAATCGTTTTGTATTGTGTTC
TACAATCTACACCTAGGTTTTCAGTGCAGGTATCTGTTTAATTCGTTATCAGTCTAATATTTCGTTGATGTACGATTTGAATTTGATATTCTGATTCTGTACAGTTCGTCATCAGTCTAT
TATATTTCGTTGATGTAGCGATTTGAATTTGATATGTCTGATTCTGTCCAGTTCGTTATCAGTCTATTATGTTTTGATGTAACGATTTGAAATTGATATATCTAATTCCGTTCAATTCGT
TATGAGTGTATGATATTCTATTGATGTAACGATTTTAACTTGATATGTATAATTATGCTTGCTTTGTTCAGAGTCTATGATATTCTGTTGATGTAATGATTTGAACTTGATATAGCTAAT
TCTGTTAATTCATTATGAGTGTATGATATTATGTTGATCAACGATTTGAACTTAATATATCTAGTTCAGTTCGTTATCGGTTTATGATATTGCATTGATGTAACGATTTGAACTTGATAT
ATCTAATTATGTTCAGTTCGTTATCAGTCAACAATGTTCCATTGATGTAACGCTTTAAACGTGAAAAATCTATTTCTGTTCGGTTTGTTATCAGTCTATAATATTCCATGGATGTAACGG
TTTGAACTTAATATATCTAATTCTGTTCGATTAATTATTAGTCAGTCTATAATGTTCAGTTAATGTAACGATTAGAACTTAATATATCTTATTCTGTTCAATTCGTTAGCAGTCTATGAT
ATTCTGTTGATGTAACGATTTCAACTTAATATATATCTTATTTTTGTTCAATTCGTTATCAGTCTATGATATTCCATTGATATAATGATCTGGACTTAATATATCTAATTAACTTCACTT
TGTTATCAGTCTATAATGTTCCATTACTGTAACTAACTGAACTTGATATGTCTAATTATGGTTGAATCGGAGGTGAATTTTATAATGATTTTGCTCTGCTCACCAGGAGCTTTTCCGTAC
TGTTTGTTAGCTGAAGATGTTGTGCTTTTTGTAGAAGATAGTTTGGGAATTGATATGTATTTGGTGAAAAACACTTAGAATTTGGATGCAAAACCTAAATTTAAAAGCAATATTGATGTT
CATTTTTGTTCTAACACTAGAAACATTAACTTTCATACGTAATTTGAAAAGTAAAATCAAAGGTTATTGTTTACTGTTTAGAGGATTAAACATGGTGCATATGACCAAGATATGATCTGT
AATTTATCGTCTCATAGCATTACATGCTCGCATAGGTATTTCACTTGATGTGTACGAGTACCTATTCTTTTTATCCATACATAATTCGTCAAACATCTAACCTTGCAATCTCCAAATTTG
TAGTCCTTCCTGTGACTGATGCAACATGGCAATCGCTAGTCTTGGAATCTGATCTCCCCGTCATGGTTGAATTCTGGGCCCCATGGTGTGGGCCCTGCCGCATGATCCACCCTGTCATTG
ATGAGCTTGCAAAGGAATACACAGGGAAACTCACATGTTACAAGGTTAATACTGATGAGAGTCCTACAATTGCAAGCCGATATGGTATCAGAAGCATCCCCACTGTCATTATATTCAAAG
ATGGAGAAAAAAAAGATGCAGTTATTGGTGCAGTTCCCAAATCAACACTATCTACCTGCATTGAGAAGTTCTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAAAGCACGTGACACTCTTCCATCCACCCAAATATCTAATCCTGTGACAGAAACCAAAACCACCACACACACATTCTCCATTTTCCATTTCCTTTTCATGGCTGCTGTGCTTGAA
ACTCTCACAGTTCCCCGTGCCTCCGCCTTTCCGGCGGCATCGTCGTCTCCGATCGTCTCTTCTGCTCGCCGGAGCTTTGTAAATTTGTCGAAATCAAAAGGTTTCAAAATCCAGTCGGTT
TCCGTTTCTGGATCGGTGAGTTTGCGGTCTAAATTAGGTCGCCGTGGATCGCGTATCGTATGTCAGGCTCAAGAAGCTGTTCAAG
TCCTTCCTGTGACTGATGCAACATGGCAATCGCTA
GTCTTGGAATCTGATCTCCCCGTCATGGTTGAATTCTGGGCCCCATGGTGTGGGCCCTGCCGCATGATCCACCCTGTCATTGATGAGCTTGCAAAGGAATACACAGGGAAACTCACATGT
TACAAGGTTAATACTGATGAGAGTCCTACAATTGCAAGCCGATATGGTATCAGAAGCATCCCCACTGTCATTATATTCAAAGATGGAGAAAAAAAAGATGCAGTTATTGGTGCAGTTCCC
AAATCAACACTATCTACCTGCATTGAGAAGTTCTTCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGAGCCATG TGCAAAGCAC GTGACACTCT TCCATCCACC CAAATATCTA ATCCTGTGAC AGAAACCAAA ACCACCACAC ACACATTCTC CATTTTCCAT TTCCTTTTCA TGGCTGCTGT  GCTTGAAACT CTCACAGTTC CCCGTGCCTC CGCCTTTCCG GCGGCATCGT CGTCTCCGAT CGTCTCTTCT GCTCGCCGGA GCTTTGTAAA TTTGTCGAAA TCAAAAGGTT TCAAAATCCA  GTCGGTTTCC GTTTCTGGAT CGGTGAGTTT GCGGTCTAAA TTAGGTCGCC GTGGATCGCG TATCGTATGT CAGGCTCAAG AAGCTGTTCA AGTCCTTCCT GTGACTGATG CAACATGGCA  ATCGCTAGTC TTGGAATCTG ATCTCCCCGT CATGGTTGAA TTCTGGGCCC CATGGTGTGG GCCCTGCCGC ATGATCCACC CTGTCATTGA TGAGCTTGCA AAGGAATACA CAGGGAAACT  CACATGTTAC AAGGTTAATA CTGATGAGAG TCCTACAATT GCAAGCCGAT ATGGTATCAG AAGCATCCCC ACTGTCATTA TATTCAAAGA TGGAGAAAAA AAAGATGCAG TTATTGGTGC  AGTTCCCAAA TCAACACTAT CTACCTGCAT TGAGAAGTTC TTCTAGAGGT ATTATTATTA TGTATATATA TAAACACGCG AGATTTGTTC GTATTTAGTT ATGTGATATC TTGCGTGCTG  TTGACCTATT GATATCATCA CAAGTACAGA TACTTCAGGT CCAATAATTT ATGCATTGTG TCTTACTCTC CAAATTTTCT AATGTTCCAA GTATATAGCC AAGATCGGCC GATGTTTTTC  TGTCGATGTT GTCAAACTGT CGGTGGGGTT TCTTGTTAAT TTTATCAACC ATTTTTTATC GTCAAGGTAG ATTGTCTTGT TAAACAACAA TATTTTACAT GTCAACTTTT AAATGCCTTA  CTTCCACAAA ACAAAAGATG GGGTTAAGGG GGGACGGGGC GCCCCCGTGA TCGGCCCCGG TCACGCATGG TACAACAAAT AACACTGCCG CCACTTGATT GTATAACGCG TCAATTTGAA  AATGCGTCAA ACACATCACG CATGAAGAAT TGAAGAATGT GAGGGTTTAT TGTTGGGTGT TGTGAGTGAT GGGCATTTCC ACTAAAATCC ATCACCAGTG ATGGAATAAA GCTCGATGAC  GTGGTGGAAC TTGATTGGAT ATTGTGAGTG ATGAGTGGGT GGTGACTGAT GGGCGCCCCG TCCGCCCTAA CATTGAGATT TGGGAGTGAA TATTATCTAG TACTATCTTG ATTAAGTGTA 
CATTATTATT TCTTTTTT 

Retrieve as FASTA