Entry information : HaTrxM02HanXRQChr04g0109501
Entry ID 14507
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM02HanXRQChr04g0109501
Name HaTrxM02HanXRQChr04g0109501
Class Thioredoxin Type M    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM02
start..stop
S start..stop
HaTrxM03 134 2e-40 29..178 30..185
PpaTrxM04 134 2e-40 46..178 50..190
HaTrxM04 130 3e-39 70..178 71..185
HaTrxM06 129 9e-39 70..178 50..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 88853860..88854094 235 N° 2 88855965..88856269 305  
join(88853860..88854094,88855965..88856269)


exon

Literature and cross-references HaTrxM02HanXRQChr04g0109501
DNA ref. HanXRQ genome:   HanXRQChr04 (88853860..88856269)
Protein sequence: HaTrxM02HanXRQChr04g0109501
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   179
PWM (Da):   %s   19506.93  
PI (pH):   %s   7.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTTKAGTNPPKKKQTMMEKCLEMSIVKTNFSGLLHTTHGPFTPTKILKPQIKPSTLTPSFSALTFNRTIACNSSVSEVEVVTACSWTELVVAADMPVLVEFWAPWCGPCQVVDEVAKEYAGKALCYKLNIDDYPNVALQYGITSIPSVLFYKNGESKEIVIGDVSKSTLCATLDKYLS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAACCACAAAAGCAGGCACCAATCCACCCAAGAAAAAACAGACGATGATGGAGAAGTGTTTAGAAATGTCTATAGTGAAAACCAATTTCAGTGGTTTATTACATACAACTCATGGC
CCTTTTACTCCCACCAAGATACTGAAGCCTCAGATTAAACCCTCCACCCTAACGCCGTCGTTTTCTGCCCTTACTTTCAACCGCACCATCGCCTGCAACTCTTCCGTAAGTGAAG
GTATC
TTTCAGTTTTAGTTCCTTTTTATCTAACAAGAAATTAATTTTAAAATAAATACAAATGTGTTTAAAACAATTAGGTTAGTCAGCCTGTCAGTTAAATATGTTTAGTGACTGAAACTGAAC
TGGTATACATTTGTTTGGTCGTTCCTTCCTAGTTCCCATTTGCTCTAGTCCCGGGTTACTAAACGGGTCATGCTCACGGGTTAGCCAATTGCCTAACACAAACTTTAACATAACAAGAAC
CCAAAAATCGTTTTCAGTGGCGGACGAGGAGTTTAACCAATTTTTCAAGGGGCGTGGACAGGATTTTGCCCTATAAAATAGGCTATTTTTTTCAAGAGCACCACCCTTACTTACTTAGGG
ATGAGCAAATCAGTGGCGGAACTAGAATATTAACTCAGGGGTATCCTAAATTTTTTTTCACCGTGCAATCGTACAATATTAAAAAAACAACAATAAATAAATAAATAAAGTAAAACAAAT
ACCCAATAGATTTGTTTTTTTTTCTTTTTTTTTTATAGCTTGAAATCGTTCCATCACATCGTCGTCTTTTACTTCATGTTAAAAATCCTTTTCGACCGCACAAACCATAGCATTGTTCAA
AAATTCTAGGCCCATTCATCCGTCTTGACAAGCTTCAATTTCGAAAAACATCTTTCAACGGTTGCGATTGCAACCGGTAAAAGCAAAGCCAGCTTCACTACCCGATAAACTGAATGAAAA
GAACTATGAGTTCCCGTTTCAACCATAACACGGGCAAGATCACTTATTCCATTCAAGTTTGCAAATTTATCACCATCGCTTATAGTGTGACGAAATGGGCAATTGGAATTTGGGCTTATT
ATTTTCAATTGATTGGTATCCTCGTAGTTGTGCCGTGTCGTGCATTAAAACCTCAAGGCAATTGGGCAATTATTTACAATATTTTATTATTTTGGGCTAACATATTGGGCAATTGGGCTT
ATTATTTACATTGTTCAAATGATTTGGGCTAACATATTGGGCAATTGAGATTTGGGCTTATTATCTTCAACTGATTTGGGCTTACAAGACTCTTTTTTAGGGGTGTCCTCATAGTTGTTC
AGGGGTATCCTTGGTATAAAAACCGAAAAAAAATTGAAATTTTACACTACCGATAAAAAGTTGAGCCGTAGCCCGTGCTACGACTCGTATAACATAGGGTCGGTACCTGGTACTGAACCG
GTACCGGTACAAATTTTACCGAACCAGGTACGTTTTCGGTACCGATTCGGTACCGACTTTTGACGGTACCGAACCATACCGGTACCAAACCGTACCAAACCGGGTATATTCAGTACCGGT
ACCTACTTTTGGGGATTTTCGGTACCGGTACTTTCGGTACCGGTACTTTCGGTTCCGGTACCGGTTCGGTACCGAGCTCATCCCTACCCTTACTAGGTCCGCCCCTTATAGTTATGGATT
GACACGAACATGACCCCTTAACCTGATTTTTTTTTTTAATTTGTATTTTTTTTCATATTAATATTATAAGATTACAACTTCAAATCAAAAGTAAAATTATGTAAAATATATTGCATGTCA
TTTCTCTTTTTAACTTTTGTGTAAAGTGCTTATGACATTATATTATAACATATTTAAAACTTAAAGAAAAAACGGGTTAAACAAGTGTACCTGTGAACCTGTCAGGTCGATTTGAACCTA
CCCGTTTTATCTAAACGTGTTCGCAGGTTTGACATGAAACTGACCCGATCATGTTTAAACTAAACTCAAACCCGAGAATTTCGTGTTAAATTTGTGTCGCGTCAAAATTCACACCCCAAA
GTTCCAACAGGACATGCATTTCTACACATGGTTAATTGGCCGGTTTGGTTTCTTGGATATTGTAGTTGAAGTGGTAACAGCCTGCTCATGGACTGAATTGGTGGTAGCAGCCGATATGCC
GGTGCTAGTGGAATTTTGGGCACCATGGTGTGGGCCATGTCAGGTGGTCGATGAAGTCGCAAAAGAATACGCGGGTAAGGCTTTGTGCTACAAGCTCAACATTGACGACTACCCCAACGT
CGCGTTACAATATGGAATCACAAGCATTCCAAGTGTGCTATTCTACAAGAACGGAGAGAGCAAAGAGATTGTGATTGGTGATGTCTCTAAGTCCACTCTTTGTGCCACTTTAGACAAGTA
CTTATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAACCACAAAAGCAGGCACCAATCCACCCAAGAAAAAACAGACGATGATGGAGAAGTGTTTAGAAATGTCTATAGTGAAAACCAATTTCAGTGGTTTATTACATACAACTCATGGC
CCTTTTACTCCCACCAAGATACTGAAGCCTCAGATTAAACCCTCCACCCTAACGCCGTCGTTTTCTGCCCTTACTTTCAACCGCACCATCGCCTGCAACTCTTCCGTAAGTGAAG
TTGAA
GTGGTAACAGCCTGCTCATGGACTGAATTGGTGGTAGCAGCCGATATGCCGGTGCTAGTGGAATTTTGGGCACCATGGTGTGGGCCATGTCAGGTGGTCGATGAAGTCGCAAAAGAATAC
GCGGGTAAGGCTTTGTGCTACAAGCTCAACATTGACGACTACCCCAACGTCGCGTTACAATATGGAATCACAAGCATTCCAAGTGTGCTATTCTACAAGAACGGAGAGAGCAAAGAGATT
GTGATTGGTGATGTCTCTAAGTCCACTCTTTGTGCCACTTTAGACAAGTACTTATCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAACCA CAAAAGCAGG CACCAATCCA CCCAAGAAAA AACAGACGAT GATGGAGAAG TGTTTAGAAA TGTCTATAGT GAAAACCAAT TTCAGTGGTT TATTACATAC AACTCATGGC  CCTTTTACTC CCACCAAGAT ACTGAAGCCT CAGATTAAAC CCTCCACCCT AACGCCGTCG TTTTCTGCCC TTACTTTCAA CCGCACCATC GCCTGCAACT CTTCCGTAAG TGAAGTTGAA  GTGGTAACAG CCTGCTCATG GACTGAATTG GTGGTAGCAG CCGATATGCC GGTGCTAGTG GAATTTTGGG CACCATGGTG TGGGCCATGT CAGGTGGTCG ATGAAGTCGC AAAAGAATAC  GCGGGTAAGG CTTTGTGCTA CAAGCTCAAC ATTGACGACT ACCCCAACGT CGCGTTACAA TATGGAATCA CAAGCATTCC AAGTGTGCTA TTCTACAAGA ACGGAGAGAG CAAAGAGATT  GTGATTGGTG ATGTCTCTAA GTCCACTCTT TGTGCCACTT TAGACAAGTA CTTATCTTGA TATACAATTG TTGTCTTGAG GTTTAGCTTA TTTGCAATTT TAAAGCAATT TAAAAAGAAA  TTGTGATCAA ATATAGTGGA CACTTGTATT TGTATATGCT ATATATAATT TGTATATGCT AATATGCTAT ATATATACAC CCACATGCTT AAGGTGTTTG AAGATGAAAA AAACACTTGA 
TTTTATTCAA CACTTGTTTT C 

Retrieve as FASTA