Entry information : HaTrxM03HanXRQChr10g0302791
Entry ID 14508
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM03HanXRQChr10g0302791
Name HaTrxM03HanXRQChr10g0302791
Class Thioredoxin Type M    [Orthogroup: TrxM001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM03
start..stop
S start..stop
HaTrxM04 292 9e-103 1..185 1..185
HaTrxM01 265 1e-91 1..185 35..212
HaTrxM06 249 4e-86 1..185 1..163
ThasTrxM04-2 203 2e-67 1..185 1..191
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172709506..172709749 244 N° 2 172710848..172711161 314  
join(172709506..172709749,172710848..172711161)


exon

Literature and cross-references HaTrxM03HanXRQChr10g0302791
DNA ref. HanXRQ genome:   HanXRQChr10 (172709506..172711161)
Protein sequence: HaTrxM03HanXRQChr10g0302791
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   185
PWM (Da):   %s   19919.37  
PI (pH):   %s   8.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGVLEILTVPRASGVPASSMSRIASSSVSRLSGCRNAVNLPESRGLKIRSFASSASVSLRSKIGRRTCRIVCEAQDTAVQVLPVTDATWQSLVLESDLPVLVEFWAPWCGPCRMIHPVIDELAKEYNGKLTCYKVNTDESPSIATKYGIRSIPTIIVFKDGEKKDAIIGAVPKSTLCTCIEKFL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGCGTTCTTGAGATCCTCACCGTTCCTCGCGCCTCCGGTGTACCGGCGTCTTCGATGTCTCGCATCGCCTCTTCTTCCGTCTCTCGGTTATCCGGCTGCCGGAATGCAGTAAAC
TTACCGGAATCCAGAGGTTTAAAGATCCGGTCATTCGCTTCTTCTGCATCAGTGAGCCTGAGGTCCAAAATCGGCCGCCGTACATGCCGTATTGTATGCGAGGCTCAAGATACAGCCGTA
CAAG
GTTAGAATTGTCCATTATTTTACCTCAATTTCTCAAGCATTGAATTGTGTTAGATTGCTTATAGCATTTTTGTTTTACACCTAATTGATACTGTAATGACCTAGGGTTTCGTATGC
CGATTTTACATTTTATTGCTCCGTTCAGTTTACAATAGAGCTACTCTTCAACTGCACAGATGCGCAGATGATATGATTTTGTTGCCATATTAACCCAAGCATTGTTGATTTTTAAAGTTG
TTATGCTTCTGTAACGCAGTAAGTTGCCCCTTAGAATATGTAAATCCATGAATTTTGAGATTGAAAAGTCATGAATCAGATGCAGCTGTTGTGTGTATAACAAATGAGTGTGTATCTGTA
AGAATTTGAGAGTATGTTGCAATCATGCTGGACATTTGGTTGTAATTATTCATCATCAGTACGTAATGTGTTTTGTTTGTTAACAATGTACAAAAGAGCTTCTATTCAACTGCACAGACG
ATATGATTTTGTTACAACACCAACACAGTTTGTTATGATTTTATAACTCAACAAGTTGCGCTAGAAAAAGGTTTAAATTCATTAACTCTGAGACTGAAAAGTATTTTGATGGACATCTGA
AGTCATGAACTCAAATGTAGCTTTTGTGAGTATAATACATGAGTATCTGTTATATCATTAAGGATTTGAGAGTATGTTGAAATCTTGCTGAACATTCGGTTGTGGTTAACTGATTATTCA
TCATCATTCATCAATAAGTAATGCATTTTGTAATTTTTGTTCGTTAACAATGTACAAAAGAGCTACTATTCAACGGCACAGATGATATGATTTTGTTGCGACATTAACACAAGCATTGTT
TCTTTTTCGATTTGTTATGGTTCTATAATGCAGCAAGTTGCAGTAGAAAAAAAGTTTAAATCCTTGAGTTTTGAGATTGAAAAGTAATTTGATGGACATATGAAGTCATGAACTCGTATG
TAGCTGTTGTGTGTGTAACAAATGAGTACTGTTATATCTTTTAGGATTTAAGAGTATGTTGCAGTCTAGCTCAACAATTGGTTGTGATTATTCATCATCAGTAAGACAATAAGTAATGCG
TTTTGTTCGTTGACAATGGCAGTGCTTCCTGTTACTGATGCAACATGGCAATCACTAGTCCTAGAGTCTGATCTCCCTGTACTAGTTGAATTCTGGGCCCCATGGTGCGGGCCGTGTCGC
ATGATCCACCCTGTCATAGATGAGCTGGCAAAGGAATACAACGGAAAACTCACTTGCTACAAAGTAAACACTGATGAGAGTCCTTCGATCGCGACCAAGTATGGAATCAGAAGCATCCCT
ACCATCATTGTTTTCAAAGACGGAGAGAAGAAAGATGCAATCATTGGTGCGGTTCCCAAATCAACATTGTGTACCTGCATAGAGAAGTTCTTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGCGTTCTTGAGATCCTCACCGTTCCTCGCGCCTCCGGTGTACCGGCGTCTTCGATGTCTCGCATCGCCTCTTCTTCCGTCTCTCGGTTATCCGGCTGCCGGAATGCAGTAAAC
TTACCGGAATCCAGAGGTTTAAAGATCCGGTCATTCGCTTCTTCTGCATCAGTGAGCCTGAGGTCCAAAATCGGCCGCCGTACATGCCGTATTGTATGCGAGGCTCAAGATACAGCCGTA
CAAG
TGCTTCCTGTTACTGATGCAACATGGCAATCACTAGTCCTAGAGTCTGATCTCCCTGTACTAGTTGAATTCTGGGCCCCATGGTGCGGGCCGTGTCGCATGATCCACCCTGTCATA
GATGAGCTGGCAAAGGAATACAACGGAAAACTCACTTGCTACAAAGTAAACACTGATGAGAGTCCTTCGATCGCGACCAAGTATGGAATCAGAAGCATCCCTACCATCATTGTTTTCAAA
GACGGAGAGAAGAAAGATGCAATCATTGGTGCGGTTCCCAAATCAACATTGTGTACCTGCATAGAGAAGTTCTTATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAAAAAGAG GCACGTGAGA AGCACGTGAG GTCTCATCCA CCAACAGTCA ATATCCCTCG GATAACCAAA CAAACTCCAT CCATCCCCCC AATCGCGTCT CTCTTCCATG GCCGGCGTTC  TTGAGATCCT CACCGTTCCT CGCGCCTCCG GTGTACCGGC GTCTTCGATG TCTCGCATCG CCTCTTCTTC CGTCTCTCGG TTATCCGGCT GCCGGAATGC AGTAAACTTA CCGGAATCCA  GAGGTTTAAA GATCCGGTCA TTCGCTTCTT CTGCATCAGT GAGCCTGAGG TCCAAAATCG GCCGCCGTAC ATGCCGTATT GTATGCGAGG CTCAAGATAC AGCCGTACAA GTGCTTCCTG  TTACTGATGC AACATGGCAA TCACTAGTCC TAGAGTCTGA TCTCCCTGTA CTAGTTGAAT TCTGGGCCCC ATGGTGCGGG CCGTGTCGCA TGATCCACCC TGTCATAGAT GAGCTGGCAA  AGGAATACAA CGGAAAACTC ACTTGCTACA AAGTAAACAC TGATGAGAGT CCTTCGATCG CGACCAAGTA TGGAATCAGA AGCATCCCTA CCATCATTGT TTTCAAAGAC GGAGAGAAGA  AAGATGCAAT CATTGGTGCG GTTCCCAAAT CAACATTGTG TACCTGCATA GAGAAGTTCT TATAGAGGTA TTATTATGTT TATACTTGTT CAACTTGAAT TTAGTGCCCT CTAGTTTGTT  TCAACTCTAT CAAGATTTTG AATTTTTAAG TATTTTGTTT CTATGTCAAG TTGATAGAAT TGGGAGTTTA GCTCGCACGC TAGGCTGATT TAAGTCTATT CGTTTTGGCT TGGTTATTCA  GCTATGTATG CGCCCTGCAG TGTATGTTTA TGTCATTCAA GGATAAAAAC CTTTTTAGAA ATTGTAAAAT GATAGCTGTG CTTCAACCTA ACTGCTGTTA TTAAAGTTCA TGAGGTTTAT  ATGAGAGCAT TTAATAGCGA ATCGATTTCA AGTTAAAAAA GTTGGATCAA AAAGCTAATA ACGGCGCCAT CTCCATCGCG CCATGGCAGC CATCTCCGGC CATAGCGCCC TGCGTTTCGG 
TGTGGGCGGC GCCATGGCGG CGCTATGGGG TGCCATACCG CCCCACTACG TATGCTCTTA GCTACATGCA ATTCAGTCAC GGAAAAGAGA TCAGGAATGT TAACCCA 

Retrieve as FASTA