Entry information : HaTrxM07HanXRQChr16g0515051
Entry ID 14512
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM07HanXRQChr16g0515051
Name HaTrxM07HanXRQChr16g0515051
Class Thioredoxin Type M    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM07
start..stop
S start..stop
HaTrxM05 169 8e-55 19..161 24..167
AtTrxM03 157 5e-50 48..161 61..174
ThasTrxM03 150 4e-47 16..161 29..182
HaTrxM04 121 9e-36 56..159 82..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102042350..102042515 166 N° 2 102041225..102041544 320  
complement(join(102041225..102041544,102042350..102042515))


exon

Literature and cross-references HaTrxM07HanXRQChr16g0515051
DNA ref. HanXRQ genome:   HanXRQChr16 (102042515..102041225)
Protein sequence: HaTrxM07HanXRQChr16g0515051
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   17962.17  
PI (pH):   %s   5.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASCTYSPISRRYPSILTPSMAQRHLKTTYDLSFRVPNNRSPLPALSMRQESAVLEVTPGSWNPSILKSETPVLVEFYTSWCEPCQMVHKLLDEIASDYPGQLERVEVNVEQEPRVAEEYGIKAVPIVVLFKNGEKRESVVGTMPKDFFVAAIERVLAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTTCTTGCACTTACTCTCCTATAAGTCGTCGTTATCCTTCCATTTTAACACCATCTATGGCTCAACGACACCTTAAAACTACCTATGATTTATCTTTTCGGGTCCCAAAT
AATCGGTCTCCTCTGCCGGCCCTCTCCATGCGCCAAGAATCTGCTG
GTATGAATTTCTTGTTTGTTTTCAAACCAATTTGTTTGTGGGTCAGTGTTACTTCTATAAATTTGTTGTTTGTA
GCATCCGTTTCTTAAACAAGTGTTCGAATCAAGTTTTATATGGACTAGTTGGTGTTTAGGCTAAATCAAACCCGTGAATTTCGTATTAGGTTTGGGTTACGTATTGTTTACGTAAGTGTA
CCGGCCAGTTGGACCAAGAACAAGACAAATAACTGGTCCGGTTGTGTCTATTTAAACCGCCTTCATTTATTAGAACCGCACTGAATTTCAGTTTTTGATTTTTATTCCTTTAAAATCTCA
TTTACTTGTTTATTACTACTTTCGTACTTTATATTTTCTGTAGTTTAAACTTGGATATATTAGTGAACAACCCCCTTGATTGTCAATATTAGTGAACTAATCATAGCCCTTGATTATCAA
TACACAAGTGTATACGCAATTATAAACCAGGATTTGATGATAAAAATACACTGGTGTATTTTACGATTTGATGATGTAAATCAATGGTCAGGATTTGTTCACTCAGTTTACAAATAAACT
AGTATTCACTATAGAACCTCACCCATAGACCCAAACAAAAAAGTTGAAATATTTTCATATGTTTTTAAATTAGTTATATATTTATATTTTAAACTACTATTTTTTTTTGACATCATCCGA
TTTTTGAAACCGGTCACACTAGTGAACCGATAAAACGTCGGGTTTGACAATAGGTCTAGTTATGAAAACGTTGTTGTCTGGTTAAAAATCCTACTCTACATAAACCCTTTGTACAATATT
TGTGAATGCAGTTTTGGAAGTAACACCAGGGTCATGGAACCCATCAATATTAAAAAGTGAAACTCCAGTGCTGGTTGAGTTCTACACCAGTTGGTGTGAACCATGTCAGATGGTGCACAA
ACTGCTCGATGAGATCGCCAGTGATTATCCCGGGCAGCTAGAGCGTGTTGAAGTCAATGTTGAGCAGGAGCCTCGAGTCGCGGAGGAATATGGTATCAAGGCTGTGCCTATTGTTGTGCT
GTTCAAAAACGGTGAGAAACGTGAGTCTGTTGTTGGCACCATGCCTAAAGACTTTTTTGTGGCAGCCATTGAACGAGTCTTGGCTAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTTCTTGCACTTACTCTCCTATAAGTCGTCGTTATCCTTCCATTTTAACACCATCTATGGCTCAACGACACCTTAAAACTACCTATGATTTATCTTTTCGGGTCCCAAAT
AATCGGTCTCCTCTGCCGGCCCTCTCCATGCGCCAAGAATCTGCTG
TTTTGGAAGTAACACCAGGGTCATGGAACCCATCAATATTAAAAAGTGAAACTCCAGTGCTGGTTGAGTTCTAC
ACCAGTTGGTGTGAACCATGTCAGATGGTGCACAAACTGCTCGATGAGATCGCCAGTGATTATCCCGGGCAGCTAGAGCGTGTTGAAGTCAATGTTGAGCAGGAGCCTCGAGTCGCGGAG
GAATATGGTATCAAGGCTGTGCCTATTGTTGTGCTGTTCAAAAACGGTGAGAAACGTGAGTCTGTTGTTGGCACCATGCCTAAAGACTTTTTTGTGGCAGCCATTGAACGAGTCTTGGCT
AGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATCCTTAC AAGATCAACA ACCTCCAAAT TATTATATCT TTATATTATC TTATTCCTTA CAACAAGTTA AAATACTTGA ATCACTACAC CTAAATATCA ACAAAAATAG AAAACGTGCA  CCATCATATC TCAATCCAAT TCGTCTATAA ACTATCATTC TTCTCATCAC ACTACAATTC ATCAGATCTG CATTCTCTGC AACTAGTGAT CTGTTCTTAA TTCACCAAAA ATAAAAATAA  AAAACAATAT TTTCTTCAAT GGCTGCTGCT TCTTGCACTT ACTCTCCTAT AAGTCGTCGT TATCCTTCCA TTTTAACACC ATCTATGGCT CAACGACACC TTAAAACTAC CTATGATTTA  TCTTTTCGGG TCCCAAATAA TCGGTCTCCT CTGCCGGCCC TCTCCATGCG CCAAGAATCT GCTGTTTTGG AAGTAACACC AGGGTCATGG AACCCATCAA TATTAAAAAG TGAAACTCCA  GTGCTGGTTG AGTTCTACAC CAGTTGGTGT GAACCATGTC AGATGGTGCA CAAACTGCTC GATGAGATCG CCAGTGATTA TCCCGGGCAG CTAGAGCGTG TTGAAGTCAA TGTTGAGCAG  GAGCCTCGAG TCGCGGAGGA ATATGGTATC AAGGCTGTGC CTATTGTTGT GCTGTTCAAA AACGGTGAGA AACGTGAGTC TGTTGTTGGC ACCATGCCTA AAGACTTTTT TGTGGCAGCC  ATTGAACGAG TCTTGGCTAG TTAGTTAATC TATTGTAAAT TAGTGCACGG GCGGACCTAG GTTATGGGCA CGTCAATAAG GGGTCAGGTT GGGGTGTCCG ACCCAGCCCG TTAGAAGGTT 
TACGTTTGGA AATGCTTGTA AAGTTTAGCT CGTTTAATTT TATGTGTACA TGAATACAAT TACATTACAT TGCACCAATA TTAATACAAG CCAATGAATA ATAATTTGAA TATTAT 

Retrieve as FASTA