Entry information : HaTrxO (HanXRQChr09g0258391)
Entry ID 14513
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxO (HanXRQChr09g0258391)
Name (synonym) HaTrxO (HanXRQChr09g0258391)
Class Thioredoxin Type O    [Orthogroup: TrxO001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxO
start..stop
S start..stop
ThasTrxO01 165 1e-52 68..188 72..192
AtTrxO01 160 2e-50 67..189 72..194
AtTrxO02 158 4e-50 67..189 37..159
ThasTrxH01 83 4e-21 78..184 5..109
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143882574..143882802 229 N° 2 143885098..143885163 66 N° 3 143885253..143885303 51 N° 4 143885443..143885522 80
N° 5 143885879..143885923 45 N° 6 143886097..143886195 99  
join(143882574..143882802,143885098..143885163,143885253..143885303,143885443..1 43885522,143885879..143885923,143886097..143886195)


exon

Literature and cross-references HaTrxO (HanXRQChr09g0258391)
DNA ref. HanXRQ genome:   HanXRQChr09 (143882574..143886195)
Protein sequence: HaTrxO (HanXRQChr09g0258391)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189
PWM (Da):   %s   20728.47  
PI (pH):   %s   8.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGIFAVRRMLRNGVYCGSLYSSVGEIASASSSNPATIPYSYSLSSVTKPSWSLTVSKFQSGQHPSNRNHFSSSSSGQSRVVTVESEDQFNSLLRKVQDESLPAIFYFTAVWCGPCRFISPLIGELSEKYTNVTTYKIDIDEGLRSALEKLDISAVPTLHFFVGGKKVSEIVGADVQRLKTTMESLYK*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGAATCTTTGCAGTTCGTCGTATGCTTCGCAATGGAGTTTACTGTGGATCTCTCTACTCATCTGTCGGTGAAATTGCATCAGCTTCTTCTTCCAATCCAGCAACAATTCCGTAC
TCCTACTCCTTATCTTCTGTGACGAAACCTTCGTGGTCACTAACTGTCTCCAAGTTTCAATCTGGACAGCATCCTTCCAATCGGAATCACTTCTCCTCATCCTCATCTG
GTGCGATTTCT
TATGTTATTCATTGATTTATGATATGCGTGTCTTGCTGGAATTAGGGTTTTCTGTTTATTATGTTTGTCATTTATTTGGTTATACAGTAACTTTTGTGATAATGTTAATGTTATTTGGAT
TAATAGATTGTGTCTCTTACTCAAGTTATCACAACACATATAAGCAATGTTTTCATTTTAAAATAAGATTTTGTCAAGCAATTGAACAACTAATTATTGATTTTTGCAATCGGATTCTGG
TTATTATTTAATTACTTTCAAAGCACACATTTAAGCATTCACTGCAGATCCTTGTATATATTATTTTTTTGTGATTTTCGACCTTTAATGTTATGAAAGTTCGTATTTATAATAAGTTTT
TGCCCAACACTCTAAATAGGGGTTAAATGCACATCCAAATACCCCATTTGGTCCATATACTTTTCGTTTGGTTTTTAGTAACATTTTTGTCAACAGAAGCATCTAAACCAATATTTTGTC
TTGAACTAAGCAGTTAATGCAGTAAAAAATTCAATATCGGTAATCGCGGTGTGATATTGGTAATTTTAATATCATGCTGAATTTATATATATAGCAATTTAACACTAACAATTCAGTATA
CTCTCCCACCATTAACAAATTAACCTTTTGCAACTTGCAAAACACTAACAATTAACAATTAAGACTTAAAACACTAATAATTGAAAGACAAATGCTAGAACTAAGAAGAAAGGTACTGAT
ATCGGGAAAATTGATGATATATCAGTCCAATATTGGTCAATATCGCTGATAATATTGGTACCGATATTCTGACCGATATTTTGCACTGATATCTCACCTGGGGACTGAAGCCATATATCA
CCGATATTTCGGTGATATATCGCGATATTAACTACATAGGTCTTGAAGACCATCGTCTATTAATAATCACTGGCTTCTTTAATATAGTTAAAACAGTCAAACCTAAAACCATGCACAGTC
TATTGAGAAAAAATGGAACTAATACCGATACGAACCCTGATGCAGGTCAGATTGCGTCAGGTTTTAACCAGCTGCTGGGTGTTCCGATTAACCCAGATTAACCCAGTCCAGTTCTGTCGC
CGATCTTTCCCCGCCTAAACCTAATTGAACAAATTAATTTTCAGAAGTAGAAGTAGTGGAGCAGTTGTGTTCTATAACCATTAGCAATAGTATTAGATAGCATTCTTGTTCATTTGTTGA
GGTGTCGATGTTTTACTTATCAATTTAGGTTTCTAACCTTGTAACCAAAGACTAGTCCATCTCGAATCGGGCCGATTATTGTTTGTATTTCTAGTGAATCAGTTTCTGAATTCCAGTTCT
CAACACCTACCCTTAACAAGCAAGAATTATTTACAGAACATGTTCATTAACCATGTTGTTTATTAACTCTAACAATTATAAATAAATTCTTATCCATTGTCGTCAATAGTGGTCGCTATA
GCGAATAGCGTAGCGTATAGGCCGAAGGTCGCTAGCTACAGGTATGTAGCCATAAAAAGCGGGATTTCAGTTTAGTTTTTTTTTAATATAAATAGCGATTAATATAGCTATAAAATAGCT
GGATTTTAGGTTTTTGTTAAATATACATGTAAAATAGCGTATGTAGCAGGGTATTTTGATATAATATACATACAAAATTTTTTTCTAGTGCATCGCTATTTATCGCTATTCGCTATGTAG
CATATAGGTACCTTATCGCTATTCGCCATTAACAACTATGCTCTTATCTTAAGGCATGTTATTCATATTGTGATCACCTTTACACTTAAAATTTATAAGACAAAGCTGTAGTTATTGACT
TTGCATGTTCTTTATCAACCCAAAGAGACCGAGAAGGGTCCTTAACTTTACTTAGTCATGTGAATGCAGTTCTATGACAAACTTGCCATCCGTGTGCTTTGTGACACATGTAGTCAGTTT
CCGATATTACTTGCTATTATTTAATACTTGTTACTCTATAGCTATAAAATAAATCTTAAAGTGATGCTATCAACCTAATGGAGATGGCAACATGTATAAGATTTAGAAACAAAGACTATT
CTCTAAATTTTAATCTGATTTAATGCTTGACATAATCTAATAAATGGGTAAAAAGTTTCACTGTTTATTTTGTATGCAAGCACCATGTGTATAGCATGGCTAAACTATATCCCACGACAT
GCTAATTGCTAACATATTCTTGGTGATGGCACACAGGCTACTGCAGTTAATGTTTTTTCATAGAATGCATGCATTTTCTTAAATATTTTCTTTTAAAGATATACTTAAAGAACGATTATA
ACAGGTCAATCTAGAGTGGTGACGGTTGAGTCAGAAGATCAATTTAATAGTTTACTTCGCAAGGTTCAAGGTAAATAAACTTGCATCCATTATAATCATTCAACCATTAGTATATACTTA
CATGTTACGTGACTCATGTATGTCCGTAATGCTATCCAGATGAATCCTTGCCAGCAATCTTCTACTTTACTGCGGTTTGGTGTGGCCCATGTGAGAATTATTCAATTTGCCTATTTATCT
AGTTTTTTAAATGCAAGATTGAATTTTATATGTGCTGAATGCGTGAATATATTTTCCAACAATTCATGTTTATTCACAATATAACGCGTGTATATTTCTTCTCGCACAGGCAGGTTTATA
TCCCCACTAATTGGGGAGTTGAGTGAGAAATACACTAATGTCACCACCTATAAGATTGACATTGATCAA
GTAAGTGTCTTTCACGCTTGCAAGTGTTATTATTGTGTTGATAAAGAATTA
AAGAGAGCGAGTTATAGAAGTTTCAAAAATATAATATGTTGTGATGGTTGTAAATACTTTCTCTATGAAACTTGAATCGCCTACTTAAGTAGTTATATACGGTCTAGCTCCTATACGTTT
TTTTATTAATCAGTCAACGTTTGTTCATGGTGCACATGGGTTTCTTATTGGGTTGAGTTGTGACGGTGAAACAAAGGGATGCCTTTTTGTAGATAATTTTTCTTTCGTCTTTGAACAATG
ATGCTTTCTGCCTTAATGTATTGTTATGAAATTTTCTTACATGTTCATTTATGTCCCAATTACAGGAAGGTCTGAGGAGTGCATTGGAGAAGTTAGACATTTCTGCTGTGGTAAACAACT
TTTGTTTAATTTAATAATTATTAATTATATTGTTATGGTAAAAATTCCATGAGGAGTATTTATAGTACAATTAGGTCGAGCAATTTATACCATAATCAAACTACAAAGGTATTTAAATAT
GGACATAATTTAGGAAATAATGATTGGCTTGTTGTGTGTGCAGCCAACTCTTCATTTCTTCGTAGGAGGGAAAAAAGTGTCGGAAATAGTTGGGGCAGATGTTCAACGACTGAAAACCAC
CATGGAGAGTCTCTACAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGAATCTTTGCAGTTCGTCGTATGCTTCGCAATGGAGTTTACTGTGGATCTCTCTACTCATCTGTCGGTGAAATTGCATCAGCTTCTTCTTCCAATCCAGCAACAATTCCGTAC
TCCTACTCCTTATCTTCTGTGACGAAACCTTCGTGGTCACTAACTGTCTCCAAGTTTCAATCTGGACAGCATCCTTCCAATCGGAATCACTTCTCCTCATCCTCATCTG
GTCAATCTAGA
GTGGTGACGGTTGAGTCAGAAGATCAATTTAATAGTTTACTTCGCAAGGTTCAAG
ATGAATCCTTGCCAGCAATCTTCTACTTTACTGCGGTTTGGTGTGGCCCATGCAGGTTTATATCC
CCACTAATTGGGGAGTTGAGTGAGAAATACACTAATGTCACCACCTATAAGATTGACATTGATCAA
GAAGGTCTGAGGAGTGCATTGGAGAAGTTAGACATTTCTGCTGTGCCAACTCTT
CATTTCTTCGTAGGAGGGAAAAAAGTGTCGGAAATAGTTGGGGCAGATGTTCAACGACTGAAAACCACCATGGAGAGTCTCTACAAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACAATCGAT TCAACCCCCA TTTGAGAAAC TTTATACGAA GTTGAAGGAC CCAGACGAAA CTATATTAGG GTAAATAATA ACCCCCAAAC CAAACCTTCA TCAAACCACC ACTTGGATTA  TCTATCAAAA CCCACACAGT CACACACACA ACACAAATGA GAGGAATCTT TGCAGTTCGT CGTATGCTTC GCAATGGAGT TTACTGTGGA TCTCTCTACT CATCTGTCGG TGAAATTGCA  TCAGCTTCTT CTTCCAATCC AGCAACAATT CCGTACTCCT ACTCCTTATC TTCTGTGACG AAACCTTCGT GGTCACTAAC TGTCTCCAAG TTTCAATCTG GACAGCATCC TTCCAATCGG  AATCACTTCT CCTCATCCTC ATCTGGTCAA TCTAGAGTGG TGACGGTTGA GTCAGAAGAT CAATTTAATA GTTTACTTCG CAAGGTTCAA GATGAATCCT TGCCAGCAAT CTTCTACTTT  ACTGCGGTTT GGTGTGGCCC ATGCAGGTTT ATATCCCCAC TAATTGGGGA GTTGAGTGAG AAATACACTA ATGTCACCAC CTATAAGATT GACATTGATC AAGAAGGTCT GAGGAGTGCA  TTGGAGAAGT TAGACATTTC TGCTGTGCCA ACTCTTCATT TCTTCGTAGG AGGGAAAAAA GTGTCGGAAA TAGTTGGGGC AGATGTTCAA CGACTGAAAA CCACCATGGA GAGTCTCTAC  AAGTGAAGGT AGCCTTTTCT GTTATGTCAG AATCTTAAGC AATACAAGGT AAAAAGATAT AGATTGTTTA CAAATCATGT ATTAGGGCTC GACTTCTGCA TAGCCTTTGC GATTGTAAAC  TCTACTTAAG TCAAACGCTT GAATTACTCA CTTGAATGCA TTGATCTTTT CGTTTTCCTC AAAGTTTCAC ACACATAGCT TTCAGCCTTT CACTCATGTT ATTATCTTCG ATTGTGACAA  CCAACTTCAT TACTTGAGCC AACCCTCTGG GTTGCATGGC TGTGTTATCA CAGAATAAGA GTAGAGTTAT TGTACATTGA ATATTCACTT AAGAAACTAT TTGGAGATAA CTACTAACTT  ATGGTATATG ATTTGTCTAA TCACTAAGTT GACAGGCACA CAGTCAACTT ATATAAAGTT GGCAGCTTCA CTTGACGACA ATTCTTAATT CTAACCAAGT GAAAGTTGTC AAAGCTGGCC  AACGCATAGT TAGCTTTTAC ATAACTTGGA CGATTCATCA AGTATGTGCA CCGATCAACA CAAATACGTT CCATGTATAA AACATGTGTC ATTAATTCTA CTCTTTAACA CAACTGGACT  GACAAACCAT ATAAGTGACC TTTAACCAGA CCTGTGTTGT ACCAACTTAG TTATATGTAT TTAGCTCGAG ATCAAAGGAA CTAGAGATCG AACAGTTAGT ATTTAGATAT AATGAACTAA 
AATTGTTAGC AATGAATTGT AATTAG 

Retrieve as FASTA