Entry information : HaENODL01HanXRQChr02g0033981
Entry ID 14520
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL01HanXRQChr02g0033981
Name HaENODL01HanXRQChr02g0033981
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL01
start..stop
S start..stop
AtENODL21 99 3e-27 9..145 13..164
ThasENODL01 85 8e-22 19..145 23..165
HarENODL19 74 7e-18 10..121 12..148
HaENODL19 74 7e-18 10..121 12..148
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14801793..14801898 106 N° 2 14799684..14800018 335  
complement(join(14799684..14800018,14801793..14801898))


exon

Literature and cross-references HaENODL01HanXRQChr02g0033981
DNA ref. HanXRQ genome:   HanXRQChr02 (14801898..14799684)
Protein sequence: HaENODL01HanXRQChr02g0033981
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   146 (124)
PWM (Da):   %s   15612.9 (13381.7) Transmb domain:   %s   i7-29o126-145i
PI (pH):   %s   9.16 (9.16) Peptide Signal:   %s   cut: 23 range:23-146
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSHLTHLILLIAAVATTVSATDHIVGANRGWNPAFRYVKNQYNVIEVNKTGYDNCTLDGYVGNWTSGKDFILLNKSQRYYFICGTGGCFNGMKVTIRVHPLPSPTSSPVAAAEHSASSVAGKSVFGVSFMVLVSLIWFGFGAIC

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCTCACACCTTACCCATCTTATCCTCCTTATCGCCGCCGTAGCAACCACCGTCTCCGCCACCGATCACATTGTCGGCGCCAACCGTGGGTGGAACCCTGGTATCAACTACACT
TTAGGTCATATGTACTGGGGCGCGTTGATTGAACATAGCGCCATTAAGGCGCCCTGCACACCGCCCCCCCGGCGCTATGTGTCAAAATTTTTGGGCAGCGCGAAGATTATAGCGGCGTGA
AGAAATGAAGAATTCAAAATTGTGACCGTTTACAAACGGTCAAATTCAAAAAAAAAAAAAAAATTAATTTCTTTTTCAACTTTCCTTTTAAAATCCTTCTCCATCTCTTTATTTTTTTAC
CATACCCATTCAAACCTTCTTATTTCTCTCAAAATTTTTTACAACTCTTGTTATTTTATACAATGAATCCATTCAACCGGGGCTTTATTCCTCCCCGATCTAGTGCGGACACAAACCAAA
GTGGCAATCCTACTCGTCCCAAAAGGAGCGGATTGAAAAAAAATATAATCTTTGATTGTGTAATTTTTTTTATGCTAGTTTAATGTTTTTTTTTTCTAGTTTCATGTTTTTTTTTATTTT
ATTGTACTTTTTTTTATTTAATGAAATGAATTTTATTTTTAAAAAAATTACAAAATGAATTAAAAAAATAAAAATTTAAAAATGAGTAATGATTACACAGGGGCTTTATGACTACGGCCT
CAAAATTCATAACGCCCCATAAAGCCTCGGGGTGACGTGGCATGCCACATGTCACATAACGCCCCTAAAAGGGCTTTATGACTACACATGCCCTAAATGGGCCAACAATCATACATTCTA
TGTTGGCGACTTTATCTGTATGTATAATGTATCCTCTCTCTACACACTCACATCCTAATTTAGTAAAGGGGTAACCCGGTTTCAACCCGAACCCGTTTTGGCTCATTTCAAAGTATAGGA
TTATAACCCGGTTTTAACTTTACGAGTCGGGTCGGGTTTAAATTGGGTTCAACACTTCAACCATTTTCGACTTCTTTTGCCTTAAAATACATGAAATTACTTGCAATGTCATGTCACATT
TTAAAAGAAAAATAATGAGTATCGTCAACATTTTTGTTAGCTTTTCTAAGAGTTAACTGTTATTTTCGTCCCTGTGGTTTGGTTAAAAATGTCACTTCAGTAAAAAAAAAAAAAAAAAAA
AATTGCGTCAATTCCGTCCTCAAAATTTTTGAAACGTGTCACTTCAGTCCAAAAAGATAACGCGCCGTTAAAAACGTTGAGGACGGAACTGGCGCAGGGCGTTATCTTTTTGAACTGAAG
TGACACGTTTCAAAAATGTTGAGGACGGAACTGGTGCATTTTTTTTTTTTACTGAAGTGGTATTTTTCACCAAACCACATAAACGAAAATGGCAGTTAACTCGCTTTTCTAATGATATAT
TTCATTTTTGTTCTTCAATAAAAAAAGCGAGAAGTCGCAAGTGTCATTGGCAACTTCTCGCTTTTTGTGCGACCAGGGCCGGCCCTCAGAATTCATATACTTTGTCCGAGCTTGAAAAAA
CGTGTCCTTAGGCCTTAACGAAATTGGGTATTGACATTGGGCTCACTAAATATCTAAACCTAATGCCAATGGACTAATAATTAATTCAAACCATAAAAATAGTTTTGTAAGTGGGTCTAT
GTCAGTGTTTGTATGAGTGTACACTATTAATTTATTTATTTTACATATATATATCGGAGTTTTTTTAAAAAATAACGTGCCCTTCTAAATATTTAGCCCTGGCCGGCCATGTGTGCGACA
TTCTAACAACCACTAAGCTAGTGATGGAGAAACTTTTATAAACAAAAATGAAGTTTAATGTTGTATGTATAATGATGTAGCATTTAGGTATGTGAAGAATCAATACAATGTGATCGAGGT
AAACAAAACCGGTTACGACAACTGCACACTCGACGGCTATGTAGGCAACTGGACAAGTGGAAAAGACTTCATTCTTCTCAACAAGTCGCAACGCTATTATTTCATCTGTGGTACAGGCGG
TTGCTTCAACGGTATGAAAGTCACCATTCGGGTTCATCCACTTCCGTCTCCTACGTCTTCCCCAGTCGCTGCTGCCGAGCACTCGGCTTCCTCTGTTGCTGGAAAATCCGTGTTCGGAGT
TTCATTTATGGTTCTGGTTTCATTGATTTGGTTTGGGTTTGGGGCCATTTGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCTCACACCTTACCCATCTTATCCTCCTTATCGCCGCCGTAGCAACCACCGTCTCCGCCACCGATCACATTGTCGGCGCCAACCGTGGGTGGAACCCTGCATTTAGGTATGTG
AAGAATCAATACAATGTGATCGAGGTAAACAAAACCGGTTACGACAACTGCACACTCGACGGCTATGTAGGCAACTGGACAAGTGGAAAAGACTTCATTCTTCTCAACAAGTCGCAACGC
TATTATTTCATCTGTGGTACAGGCGGTTGCTTCAACGGTATGAAAGTCACCATTCGGGTTCATCCACTTCCGTCTCCTACGTCTTCCCCAGTCGCTGCTGCCGAGCACTCGGCTTCCTCT
GTTGCTGGAAAATCCGTGTTCGGAGTTTCATTTATGGTTCTGGTTTCATTGATTTGGTTTGGGTTTGGGGCCATTTGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACCT CACACCTTAC CCATCTTATC CTCCTTATCG CCGCCGTAGC AACCACCGTC TCCGCCACCG ATCACATTGT CGGCGCCAAC CGTGGGTGGA ACCCTGCATT TAGGTATGTG  AAGAATCAAT ACAATGTGAT CGAGGTAAAC AAAACCGGTT ACGACAACTG CACACTCGAC GGCTATGTAG GCAACTGGAC AAGTGGAAAA GACTTCATTC TTCTCAACAA GTCGCAACGC  TATTATTTCA TCTGTGGTAC AGGCGGTTGC TTCAACGGTA TGAAAGTCAC CATTCGGGTT CATCCACTTC CGTCTCCTAC GTCTTCCCCA GTCGCTGCTG CCGAGCACTC GGCTTCCTCT 
GTTGCTGGAA AATCCGTGTT CGGAGTTTCA TTTATGGTTC TGGTTTCATT GATTTGGTTT GGGTTTGGGG CCATTTGTTA G 

Retrieve as FASTA