Entry information : HaENODL02HanXRQChr03g0086111
Entry ID 14521
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL02HanXRQChr03g0086111
Name HaENODL02HanXRQChr03g0086111
Class Early nodulin    [Orthogroup: ENODL002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL02
start..stop
S start..stop
HarENODL02 389 6e-141 1..193 1..193
ThasENODL12 157 2e-49 13..166 30..175
AtENODL04 155 1e-48 1..158 11..160
HaENODL12 112 1e-31 1..148 4..152
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145471236..145471410 175 N° 2 145470750..145471156 407  
complement(join(145470750..145471156,145471236..145471410))


exon

Literature and cross-references HaENODL02HanXRQChr03g0086111
DNA ref. HanXRQ genome:   HanXRQChr03 (145471410..145470750)
Protein sequence: HaENODL02HanXRQChr03g0086111
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193 (172)
PWM (Da):   %s   20541.38 (18171.1)  
PI (pH):   %s   7.12 (7.17) Peptide Signal:   %s   cut: 22 range:22-193
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKLSCLILFFMLIESNVFAYQYQVGNLQAWNIPTSADPKVYTNWPKKLTFRIGDSLLFLYPPSQDSLIQVTKESYNTCNLKNPILYMNDGNSLFNITSPGVFYFTSGASGHCEKSQKLQISVYASDGSLPEPPAYGPSGALADSAPSYPTVFGGIPTGPSPSSSSSLNIKTSFLIAAVIGVLVCGLASGKI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTTAAATTGTCGTGTTTAATCTTGTTCTTCATGTTGATAGAATCAAATGTGTTTGCATATCAATACCAAGTTGGAAATCTTCAAGCTTGGAACATACCCACCTCAGCAGATCCA
AAAGTTTACACAAACTGGCCGAAAAAACTCACTTTCAGGATCGGCGATTCGCTGT
GTAAGTTCAAAACCATATATAATTCAATCAAAAAAAGTGTTATTAATATCTTGAACTTAAAATGT
GTGTGATTTTGCAGTGTTTTTGTACCCACCAAGCCAAGATTCACTAATTCAAGTGACAAAAGAATCCTACAACACTTGCAATCTAAAGAATCCAATCTTGTACATGAATGATGGAAATTC
TTTATTCAACATTACTTCTCCTGGTGTTTTTTACTTCACTAGTGGTGCTTCGGGTCATTGCGAAAAATCGCAAAAGCTTCAGATTTCTGTGTACGCTAGTGATGGGTCATTGCCTGAACC
ACCCGCCTACGGTCCCAGTGGTGCATTGGCTGATTCGGCGCCTTCTTACCCGACTGTTTTTGGTGGGATACCAACTGGACCATCGCCATCATCTTCGTCCTCGTTGAATATTAAAACATC
ATTTTTAATTGCTGCAGTCATTGGAGTTTTGGTTTGTGGTTTAGCTAGTGGCAAGATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTTAAATTGTCGTGTTTAATCTTGTTCTTCATGTTGATAGAATCAAATGTGTTTGCATATCAATACCAAGTTGGAAATCTTCAAGCTTGGAACATACCCACCTCAGCAGATCCA
AAAGTTTACACAAACTGGCCGAAAAAACTCACTTTCAGGATCGGCGATTCGCTGT
TGTTTTTGTACCCACCAAGCCAAGATTCACTAATTCAAGTGACAAAAGAATCCTACAACACTTGC
AATCTAAAGAATCCAATCTTGTACATGAATGATGGAAATTCTTTATTCAACATTACTTCTCCTGGTGTTTTTTACTTCACTAGTGGTGCTTCGGGTCATTGCGAAAAATCGCAAAAGCTT
CAGATTTCTGTGTACGCTAGTGATGGGTCATTGCCTGAACCACCCGCCTACGGTCCCAGTGGTGCATTGGCTGATTCGGCGCCTTCTTACCCGACTGTTTTTGGTGGGATACCAACTGGA
CCATCGCCATCATCTTCGTCCTCGTTGAATATTAAAACATCATTTTTAATTGCTGCAGTCATTGGAGTTTTGGTTTGTGGTTTAGCTAGTGGCAAGATATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAAATTCTA CCCTCTCTCT ATATATATAC ATACATATAT GTGTGTATCT AAGTTTGACA AGGAGAAACA GAAAACACAG AAAAAAAGGG GAAATGGCGG TTAAATTGTC GTGTTTAATC  TTGTTCTTCA TGTTGATAGA ATCAAATGTG TTTGCATATC AATACCAAGT TGGAAATCTT CAAGCTTGGA ACATACCCAC CTCAGCAGAT CCAAAAGTTT ACACAAACTG GCCGAAAAAA  CTCACTTTCA GGATCGGCGA TTCGCTGTTG TTTTTGTACC CACCAAGCCA AGATTCACTA ATTCAAGTGA CAAAAGAATC CTACAACACT TGCAATCTAA AGAATCCAAT CTTGTACATG  AATGATGGAA ATTCTTTATT CAACATTACT TCTCCTGGTG TTTTTTACTT CACTAGTGGT GCTTCGGGTC ATTGCGAAAA ATCGCAAAAG CTTCAGATTT CTGTGTACGC TAGTGATGGG  TCATTGCCTG AACCACCCGC CTACGGTCCC AGTGGTGCAT TGGCTGATTC GGCGCCTTCT TACCCGACTG TTTTTGGTGG GATACCAACT GGACCATCGC CATCATCTTC GTCCTCGTTG  AATATTAAAA CATCATTTTT AATTGCTGCA GTCATTGGAG TTTTGGTTTG TGGTTTAGCT AGTGGCAAGA TATAGGATGA AGTGATTTAT TTTGTGTAAT TGAGTACAAG ATTACATTTT  TTCTTTTCCC CATTTGTTCA AAGGTATGCA GTGATATTAT TTGTACCATA TTTAAAAAAG GATATTGTGA TTTGGAATTT TTACCTTTTG TGAGTATCAA GAACGACAGG CAGTAGCAGC 
AGCTTTCGTG CATTATTGAA TCAAATAATA AGATTATAAT TTAATTTAAT TTAATTTATA GA 

Retrieve as FASTA