Entry information : HaENODL03HanXRQChr05g0159191
Entry ID 14522
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL03HanXRQChr05g0159191
Name HaENODL03HanXRQChr05g0159191
Class Early nodulin    [Orthogroup: ENODL008]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL03
start..stop
S start..stop
HaENODL11 194 6e-64 28..185 18..182
HarENODL17 181 1e-58 14..188 1..212
HaENODL17 181 1e-58 14..188 1..212
ThasENODL04 154 4e-48 19..158 14..161
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 205457513..205457705 193 N° 2 205456451..205456827 377  
complement(join(205456451..205456827,205457513..205457705))


exon

Literature and cross-references HaENODL03HanXRQChr05g0159191
DNA ref. HanXRQ genome:   HanXRQChr05 (205457705..205456451)
Protein sequence: HaENODL03HanXRQChr05g0159191
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189 (157)
PWM (Da):   %s   20338.82 (16983.1) Transmb domain:   %s   o10-27i
PI (pH):   %s   4.7 (4.57) Peptide Signal:   %s   cut: 33 range:33-189
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANFVTSHHNPTMIAAIVAVLSLLVLIQNADAYEFKVGGSGEWSLSASYNQWAEKNRFQVGDTLLFKYDDDKDSVLEVSKEDYDNCNTGNPIAKHDDGHTVIRLDRSGPHYFISGVADHCKNNEKMLVVVMADRTHKSPPESPPSPAPSGEESPSPPADEKPPSSSPSDASSVVMSLLCFIGAIACFLS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAACTTTGTCACTAGCCACCATAATCCGACTATGATTGCCGCCATTGTGGCGGTTTTAAGCCTTTTAGTGTTGATTCAGAATGCAGATGCGTATGAATTCAAAGTCGGCGGTTCA
GGGGAGTGGAGCCTTTCGGCTTCCTACAATCAATGGGCCGAGAAAAATCGATTTCAAGTTGGTGACACGTTAC
GTGAGTTTCTACATTTCCATTATATTTGGGCATTTAAATTTATTGAT
AATTGTATTTTCCGGTTTGGGTTTATACCAAACGGGTTAGGGAAGCTTATGTATGTCCCTGCAAACACGTCTATAGCTAAATGGGCCATCTTCTGGTCGACGTGGCGGGTTTGCAAGTTG
ACCCGTTTATTTTTAAAAAATTTTAAACAAATATGTTTTATACGGTAACATAATCTGATTAGATAGATATATTATGCCAAAATTTAAAAGATAAAAGAGACATGCACATTAAGTTTTATA
GTTTAAATGTAATTATTTAACATACATTTGCATTTAGAGTATGAATATGCAAAAAAAAAAAAAAAAAATGAAATAAAAAATTTTGAGTTAAACAGATCGTATTCGTGTCAACATGTGAAA
ACTCGTGTCGTGTTCAGTTTATTGGGCCTGACACAATTTTCAAGTTCGTGCCGTGTTTGATCTACCAATTTACAAACACGGCCCATTTAACAGCCCTAGTTTAAGCTGAGGTCCCATTTT
ATGTGTGGGTCAATTGTTGGACTCCATTCTCTGTTTTACTAGGCCCTTTAAGATTCCTAGCATGTTGGGCTACATTTGGGCTTTATGCTCATTTTATTAAGGCTTAGAGCCCAAACTATC
AAAATAATATTATAGAATTACTATTTTGGCCCTTACAGTGTTCAAGTATGACGATGATAAAGACTCGGTACTTGAAGTGAGCAAAGAAGATTATGACAACTGTAATACCGGTAATCCCAT
TGCAAAACATGACGATGGTCACACGGTGATCAGGTTGGATCGGTCCGGGCCCCACTACTTCATAAGTGGAGTTGCTGATCATTGCAAAAACAATGAGAAAATGCTGGTGGTGGTAATGGC
GGACCGAACCCACAAATCACCACCAGAGTCTCCACCGTCCCCAGCTCCATCAGGCGAAGAGTCACCATCTCCACCAGCGGATGAGAAACCGCCATCTTCGTCTCCAAGTGACGCGTCTTC
GGTTGTCATGAGCCTTCTTTGCTTCATTGGAGCAATTGCTTGTTTTTTGAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAACTTTGTCACTAGCCACCATAATCCGACTATGATTGCCGCCATTGTGGCGGTTTTAAGCCTTTTAGTGTTGATTCAGAATGCAGATGCGTATGAATTCAAAGTCGGCGGTTCA
GGGGAGTGGAGCCTTTCGGCTTCCTACAATCAATGGGCCGAGAAAAATCGATTTCAAGTTGGTGACACGTTAC
TGTTCAAGTATGACGATGATAAAGACTCGGTACTTGAAGTGAGCAAA
GAAGATTATGACAACTGTAATACCGGTAATCCCATTGCAAAACATGACGATGGTCACACGGTGATCAGGTTGGATCGGTCCGGGCCCCACTACTTCATAAGTGGAGTTGCTGATCATTGC
AAAAACAATGAGAAAATGCTGGTGGTGGTAATGGCGGACCGAACCCACAAATCACCACCAGAGTCTCCACCGTCCCCAGCTCCATCAGGCGAAGAGTCACCATCTCCACCAGCGGATGAG
AAACCGCCATCTTCGTCTCCAAGTGACGCGTCTTCGGTTGTCATGAGCCTTCTTTGCTTCATTGGAGCAATTGCTTGTTTTTTGAGTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCCTCATCT TCTGCATTCA TTTGCCTGCC ATTGTTTCTA GTTTAACATG GCAAACTTTG TCACTAGCCA CCATAATCCG ACTATGATTG CCGCCATTGT GGCGGTTTTA AGCCTTTTAG  TGTTGATTCA GAATGCAGAT GCGTATGAAT TCAAAGTCGG CGGTTCAGGG GAGTGGAGCC TTTCGGCTTC CTACAATCAA TGGGCCGAGA AAAATCGATT TCAAGTTGGT GACACGTTAC  TGTTCAAGTA TGACGATGAT AAAGACTCGG TACTTGAAGT GAGCAAAGAA GATTATGACA ACTGTAATAC CGGTAATCCC ATTGCAAAAC ATGACGATGG TCACACGGTG ATCAGGTTGG  ATCGGTCCGG GCCCCACTAC TTCATAAGTG GAGTTGCTGA TCATTGCAAA AACAATGAGA AAATGCTGGT GGTGGTAATG GCGGACCGAA CCCACAAATC ACCACCAGAG TCTCCACCGT  CCCCAGCTCC ATCAGGCGAA GAGTCACCAT CTCCACCAGC GGATGAGAAA CCGCCATCTT CGTCTCCAAG TGACGCGTCT TCGGTTGTCA TGAGCCTTCT TTGCTTCATT GGAGCAATTG  CTTGTTTTTT GAGTTGATGA TTTGCATATG AAGTGTTTGT TTTTTTTTTT ACTTTTTTAA TTATTTCAAA TTATATGTTG CATTTTGGTT TGTGTTGTAT TTGATTGTCT ATTGTCTAGT 
ATGAAAAATG TTTGCATATG AGGAAATAAA TTGGTATTTG TTTTGTGTGG ATAA 

Retrieve as FASTA