Entry information : HaENODL04HanXRQChr09g0264051
Entry ID 14523
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL04HanXRQChr09g0264051
Name HaENODL04HanXRQChr09g0264051
Class Early nodulin    [Orthogroup: ENODL007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL04
start..stop
S start..stop
HarENODL19 271 3e-95 1..166 1..162
HaENODL19 271 3e-95 1..166 1..162
HaENODL20 249 2e-86 1..168 1..166
ThasENODL13 128 1e-38 10..131 9..129
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166558746..166558935 190 N° 2 166557584..166557900 317  
complement(join(166557584..166557900,166558746..166558935))


exon

Literature and cross-references HaENODL04HanXRQChr09g0264051
DNA ref. HanXRQ genome:   HanXRQChr09 (166558935..166557584)
Protein sequence: HaENODL04HanXRQChr09g0264051
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18843.51 Transmb domain:   %s   i5-27o145-167i
PI (pH):   %s   8.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRSGGVVWLNTVVAVVATAAMLTGVMCRNPVRHLVGGKERWKPNFNYTDWSRQQVFYVGDWLYFVYDKHLFNVLEVNETSYSNCTDYGFIFNITRGAGRDVFELTQPKPYYFLASGGYCYNGMKVAVNVVEFVPAPQPSPAISGCYMIIGINPLILSIIIAVWAIFV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGATCAGGTGGCGTTGTATGGCTGAACACGGTGGTCGCCGTCGTGGCCACGGCGGCGATGTTGACCGGTGTTATGTGTAGAAATCCGGTGCGTCACCTCGTCGGCGGAAAGGAG
AGGTGGAAACCTAATTTTAACTACACTGATTGGTCACGTCAGCAGGTGTTCTACGTCGGCGACTGGCTTT
GTAATAATCTCTTTATATCTCTGTTTTACACACACTTTGATTTGATTTGC
GGTTACATTCGAACAATCATCTAGCGATGTAATCTTTGAATTACGTTTTTTGTCTTGATATTCAAGGAGTTTCAGGAGATTTGTGATACACTTTTGAATTTGTAGTAACTTCTTCCGATT
TCAGCGTAAACTTTTGAATGTTCGTTGGATAAGGAGCATTTTTTTTTGTTTAATCGTTATTTAGATCATTAATGTCTTCGCTTACTTGCATTTGCTCGGTTTTTTGGACGATAAAGTGAT
TCATCTCTTCCTCTAAATCATAATTTTAGTTTAAAATGATCAGATCTTCTGTTATGAAACTGTGAGCTGATTTCGTGTACGACAAGCATTTGTTTAATTTTTAAATTTTTAGCAACTTCC
GATTTCAGCGCAAATATTTGAATGTTCATCGTATAAGTAGCATTTTTCCGTTTAATCATTATCTAAATTTCTAATATGTTTGTTTGCTTGCATTTTTTTTAGATTTTTGGATGATAAAGT
GATTCATCTCTTCATCTAAATCATAATATCAATTTAAAATGATTGGATCTACTGTTTCGAAACTTTTGATCAGATTTCTTGTACGACAAGCATTTGTTTAATTATAAATTTGGAGCCACT
TCTCCGATTTCAGCGCAAACTTTTGCATATTCCTCCAATACGTAGCATTTTTTTTCTGTTCAATCATTATTTAGATCCATAATGTGTTCATTTACTTGCATTTGTTCAGTTTTTTGGATG
ATAAAGTGATTCATCTCTTCATCTAAATCATAATATTATTTAGAATGTTCTGATCTGTTTTGAAACTTTGTGCAGATTTCGTGTACGACAAGCATTTGTTCAATGTGTTGGAGGTGAATG
AAACGAGCTACAGCAACTGCACTGACTACGGATTCATCTTCAACATCACTAGAGGCGCAGGACGTGATGTGTTTGAGCTCACTCAGCCTAAACCATACTATTTCCTTGCAAGTGGTGGTT
ACTGCTACAATGGCATGAAAGTGGCTGTAAATGTGGTTGAATTCGTTCCTGCTCCTCAACCTTCTCCGGCAATAAGCGGTTGCTATATGATCATAGGAATCAATCCACTCATCTTATCAA
TCATCATCGCGGTATGGGCCATTTTCGTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGATCAGGTGGCGTTGTATGGCTGAACACGGTGGTCGCCGTCGTGGCCACGGCGGCGATGTTGACCGGTGTTATGTGTAGAAATCCGGTGCGTCACCTCGTCGGCGGAAAGGAG
AGGTGGAAACCTAATTTTAACTACACTGATTGGTCACGTCAGCAGGTGTTCTACGTCGGCGACTGGCTTT
ATTTCGTGTACGACAAGCATTTGTTCAATGTGTTGGAGGTGAATGAAACG
AGCTACAGCAACTGCACTGACTACGGATTCATCTTCAACATCACTAGAGGCGCAGGACGTGATGTGTTTGAGCTCACTCAGCCTAAACCATACTATTTCCTTGCAAGTGGTGGTTACTGC
TACAATGGCATGAAAGTGGCTGTAAATGTGGTTGAATTCGTTCCTGCTCCTCAACCTTCTCCGGCAATAAGCGGTTGCTATATGATCATAGGAATCAATCCACTCATCTTATCAATCATC
ATCGCGGTATGGGCCATTTTCGTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAATTGTCC CTCAACACTG CCAACCTGCC GTACATCCTA ACCGTTTTGG GGATATTTAT CACTCACATC ATTTGCGTGT TTTTCTGTAT TCCATTTGAA GCTTCACTGA CAATGAGACG  ATCAGGTGGC GTTGTATGGC TGAACACGGT GGTCGCCGTC GTGGCCACGG CGGCGATGTT GACCGGTGTT ATGTGTAGAA ATCCGGTGCG TCACCTCGTC GGCGGAAAGG AGAGGTGGAA  ACCTAATTTT AACTACACTG ATTGGTCACG TCAGCAGGTG TTCTACGTCG GCGACTGGCT TTATTTCGTG TACGACAAGC ATTTGTTCAA TGTGTTGGAG GTGAATGAAA CGAGCTACAG  CAACTGCACT GACTACGGAT TCATCTTCAA CATCACTAGA GGCGCAGGAC GTGATGTGTT TGAGCTCACT CAGCCTAAAC CATACTATTT CCTTGCAAGT GGTGGTTACT GCTACAATGG  CATGAAAGTG GCTGTAAATG TGGTTGAATT CGTTCCTGCT CCTCAACCTT CTCCGGCAAT AAGCGGTTGC TATATGATCA TAGGAATCAA TCCACTCATC TTATCAATCA TCATCGCGGT  ATGGGCCATT TTCGTTTAAG ATCGGTAAAG AACAGGAACT AGACTGGTTT GATTAGCTAT TAGTTGATTA TGATTAGTTA TAACATTGAT CTAGAAATCA ATTATAGTTT GAGTTGGATT 
AAGAAAATCT TAGATTTTGG ATTGGAAGTT TAACTGATTG TTATAAGGAT CTGATTGACC CATGGATCAG TGTGCTTGAT TATCTTACTT AATTAAATGC ATATTATTTT TGATGTCA 

Retrieve as FASTA