Entry information : HaENODL05HanXRQChr09g0264061
Entry ID 14524
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL05HanXRQChr09g0264061
Name HaENODL05HanXRQChr09g0264061
Class Early nodulin    [Orthogroup: ENODL006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL05
start..stop
S start..stop
HaENODL06 247 6e-85 12..203 1..167
HaENODL21 231 2e-78 17..203 2..164
AtENODL21 140 6e-43 21..147 3..131
ThasENODL01 131 3e-39 39..147 23..131
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166568930..166569152 223 N° 2 166568141..166568529 389  
complement(join(166568141..166568529,166568930..166569152))


exon

Literature and cross-references HaENODL05HanXRQChr09g0264061
DNA ref. HanXRQ genome:   HanXRQChr09 (166569152..166568141)
Protein sequence: HaENODL05HanXRQChr09g0264061
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   22387.35  
PI (pH):   %s   9.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPNLTSHSNPVGRNNGGSKRATAVASAFCATLVMMLPEVSAKRFIVGGNMGWTSDVNYTLWAEYQTFYLGNWLFFVYDRNQDDVIEVNKTNYETCNAKHPVHNYTTGSGRDVVTLNVTHDRYFISSKRSCHGGMRLQVHLTPIPQPAPLPQPAHLAPLPPPPVYLAPKQQPPRAAPSRSYSSRFTVLKSQLLIPFFVTIAAI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAAATTTGACATCACACTCCAATCCAGTGGGGCGGAACAACGGCGGTAGTAAACGGGCCACTGCGGTGGCTTCGGCATTCTGCGCCACATTAGTCATGATGTTACCAGAAGTT
TCCGCCAAGCGGTTCATTGTCGGAGGAAACATGGGCTGGACTTCCGACGTTAACTACACTCTTTGGGCCGAATACCAAACATTCTACCTCGGCAACTGGCTAT
GTAAGTATCTATCTAAG
ATCTGTAGTAATTTCAAATGTAGAAAATTTTCAACATCTTTGAAATGGTGATAGGGAAATAAAGATGGTCGAAATTAAATTACCGAGCTTGGCTAAGCTTATAATATAAACGAATCTAGT
ATTTATATAAATAAAATAATTTTTATTTTAAATAATAAATATTTAATAACTAAAATAAATTTGCCATACATATACTCTTTGCTTTTGGTCTTTTGTTTGTTAAATGAAAGCCAAAAAAAT
ATGAATGATCATGTTGTTATTGGTGCCTCATATATGTTAAACAGAATATGCAACACGTACTATGTAGAACTAGAAACCTTTGTTTTTGCATTGTACTAATTTTCAAGTTAGATAATTTAT
TTTGGTCTTAATCATACTTGCAGTTTTCGTGTACGACAGAAACCAGGACGATGTAATTGAAGTGAATAAGACCAACTATGAAACCTGCAATGCCAAGCATCCGGTTCACAATTACACGAC
AGGATCCGGAAGAGACGTAGTGACACTCAATGTCACCCATGACCGCTACTTCATTAGTAGCAAAAGGTCTTGCCATGGTGGCATGAGATTGCAAGTACATCTCACTCCTATACCACAACC
CGCTCCCTTACCACAACCCGCACATCTCGCACCTTTACCACCACCACCAGTATATCTAGCTCCTAAACAACAACCACCACGAGCCGCCCCTTCAAGGAGTTACTCTTCGAGATTCACTGT
CCTTAAAAGCCAGCTCCTGATCCCTTTTTTCGTCACGATTGCCGCCATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAAATTTGACATCACACTCCAATCCAGTGGGGCGGAACAACGGCGGTAGTAAACGGGCCACTGCGGTGGCTTCGGCATTCTGCGCCACATTAGTCATGATGTTACCAGAAGTT
TCCGCCAAGCGGTTCATTGTCGGAGGAAACATGGGCTGGACTTCCGACGTTAACTACACTCTTTGGGCCGAATACCAAACATTCTACCTCGGCAACTGGCTAT
TTTTCGTGTACGACAGA
AACCAGGACGATGTAATTGAAGTGAATAAGACCAACTATGAAACCTGCAATGCCAAGCATCCGGTTCACAATTACACGACAGGATCCGGAAGAGACGTAGTGACACTCAATGTCACCCAT
GACCGCTACTTCATTAGTAGCAAAAGGTCTTGCCATGGTGGCATGAGATTGCAAGTACATCTCACTCCTATACCACAACCCGCTCCCTTACCACAACCCGCACATCTCGCACCTTTACCA
CCACCACCAGTATATCTAGCTCCTAAACAACAACCACCACGAGCCGCCCCTTCAAGGAGTTACTCTTCGAGATTCACTGTCCTTAAAAGCCAGCTCCTGATCCCTTTTTTCGTCACGATT
GCCGCCATATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAA ATTTGACATC ACACTCCAAT CCAGTGGGGC GGAACAACGG CGGTAGTAAA CGGGCCACTG CGGTGGCTTC GGCATTCTGC GCCACATTAG TCATGATGTT ACCAGAAGTT  TCCGCCAAGC GGTTCATTGT CGGAGGAAAC ATGGGCTGGA CTTCCGACGT TAACTACACT CTTTGGGCCG AATACCAAAC ATTCTACCTC GGCAACTGGC TATTTTTCGT GTACGACAGA  AACCAGGACG ATGTAATTGA AGTGAATAAG ACCAACTATG AAACCTGCAA TGCCAAGCAT CCGGTTCACA ATTACACGAC AGGATCCGGA AGAGACGTAG TGACACTCAA TGTCACCCAT  GACCGCTACT TCATTAGTAG CAAAAGGTCT TGCCATGGTG GCATGAGATT GCAAGTACAT CTCACTCCTA TACCACAACC CGCTCCCTTA CCACAACCCG CACATCTCGC ACCTTTACCA  CCACCACCAG TATATCTAGC TCCTAAACAA CAACCACCAC GAGCCGCCCC TTCAAGGAGT TACTCTTCGA GATTCACTGT CCTTAAAAGC CAGCTCCTGA TCCCTTTTTT CGTCACGATT 
GCCGCCATAT AG 

Retrieve as FASTA