Entry information : HaENODL06HanXRQChr09g0264071
Entry ID 14525
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL06HanXRQChr09g0264071
Name HaENODL06HanXRQChr09g0264071
Class Early nodulin    [Orthogroup: ENODL006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL06
start..stop
S start..stop
HaENODL21 278 1e-97 6..175 2..172
HaENODL05 261 1e-90 1..167 12..203
AtENODL21 171 2e-55 12..171 7..168
ThasENODL01 165 5e-53 28..172 23..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166574514..166574703 190 N° 2 166573539..166573876 338  
complement(join(166573539..166573876,166574514..166574703))


exon

Literature and cross-references HaENODL06HanXRQChr09g0264071
DNA ref. HanXRQ genome:   HanXRQChr09 (166574703..166573539)
Protein sequence: HaENODL06HanXRQChr09g0264071
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175 (144)
PWM (Da):   %s   19232.75 (16032.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.81 (8.68) Peptide Signal:   %s   cut: 32 range:32-175
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSNGGSRWAMVVALAFCATLVILLPEVSAKRFIVGGNMGWTSNVNYTLWAGNQTFYFGDWLFFVYDRNQNDVIEVNQTNYETCNAEHPIHNYTTGAGRDVVALNVTHDRYFISSKGACYGGMKLHVHLSPLPPPPKSAPAKSHSSRFTVLRSQLVIPAVLAVAAIWDSLLLRV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGGAGCAACGGCGGCAGCAGGTGGGCCATGGTGGTGGCTTTGGCATTCTGCGCCACATTAGTCATTTTGCTACCGGAAGTTTCCGCCAAAAGGTTCATCGTCGGAGGAAATATG
GGCTGGACTTCCAATGTTAACTACACTCTTTGGGCCGGAAACCAAACATTCTACTTCGGTGACTGGCTTT
GTAAGTATTCTTCTCAGATCTACTGTTTTCGCTATCTAGTTGTTCTGTTT
ATGGATGTAGATCTCTTGGGTATGTCTCTGTTTCACTGGTTTTGAACCTAGTTACTGTACTAGATCTTTGGGTAGAGATGCGTTTTTTTTTTTTTTTTTAATATTTGTTTGTGCTAATTT
AAATTTATTATTGTTTATTGACCCTTTAAACCTCTGTGGTTTGAATAGTGGTAAATACTGCAATACTGCATACCTGATTCTATTATGAATAGATAAATTGATTTGATTCCCTATGCGTTC
ATAATCGGTTATTGCTTTTTGATTGTGCATTTGTACAGCTAAGCAATGAATAGTATCTTTGTTATTCAGCTGACCTAATATTTTCCAAACTGAAATCAATTGGAAATGATGTTATTGATG
GTAAAAATGTATTCGGAGGCGAGTGTATCCCGATGCGGTGAATTTCACAAGTAGCCAAATTTGGATTTGGAGGATTCGTTGGCGGTTCAGAATAAAAGTTTATATAATTCTGTTCTCAGA
TTAATTTAATCAGATCTAAAATTCTCATTGCATTTACCATATATGAGCCAAAAACTGGTCAAGGTTACCATATTTTTCGGTCTTAATATTATTTTTCTTTCTTGCAGTTTTCGTGTACGA
CAGAAACCAGAACGATGTAATTGAAGTGAACCAGACCAACTATGAAACCTGCAATGCCGAGCATCCAATTCACAATTACACAACAGGAGCCGGAAGAGACGTAGTGGCACTCAATGTCAC
CCATGACCGCTACTTCATTAGTAGCAAAGGGGCGTGCTACGGTGGCATGAAACTTCACGTACATCTCAGTCCGCTACCACCACCACCAAAATCCGCGCCTGCAAAGAGTCACTCTTCAAG
ATTCACCGTCCTTAGAAGCCAGCTCGTGATCCCTGCTGTCCTCGCTGTTGCCGCAATATGGGACTCGCTACTTCTTCGTGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGGAGCAACGGCGGCAGCAGGTGGGCCATGGTGGTGGCTTTGGCATTCTGCGCCACATTAGTCATTTTGCTACCGGAAGTTTCCGCCAAAAGGTTCATCGTCGGAGGAAATATG
GGCTGGACTTCCAATGTTAACTACACTCTTTGGGCCGGAAACCAAACATTCTACTTCGGTGACTGGCTTT
TTTTCGTGTACGACAGAAACCAGAACGATGTAATTGAAGTGAACCAGACC
AACTATGAAACCTGCAATGCCGAGCATCCAATTCACAATTACACAACAGGAGCCGGAAGAGACGTAGTGGCACTCAATGTCACCCATGACCGCTACTTCATTAGTAGCAAAGGGGCGTGC
TACGGTGGCATGAAACTTCACGTACATCTCAGTCCGCTACCACCACCACCAAAATCCGCGCCTGCAAAGAGTCACTCTTCAAGATTCACCGTCCTTAGAAGCCAGCTCGTGATCCCTGCT
GTCCTCGCTGTTGCCGCAATATGGGACTCGCTACTTCTTCGTGTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAATTTAA TCGTGCGACG CTCCGTTCCA GTTTATAAGA CAAAGCCCAC ACCACTTCTC AACATTTCTA GAAAAACCTC GTAACTTAAA ACACCCGACA GAATCCACAA TGGGGCGGAG  CAACGGCGGC AGCAGGTGGG CCATGGTGGT GGCTTTGGCA TTCTGCGCCA CATTAGTCAT TTTGCTACCG GAAGTTTCCG CCAAAAGGTT CATCGTCGGA GGAAATATGG GCTGGACTTC  CAATGTTAAC TACACTCTTT GGGCCGGAAA CCAAACATTC TACTTCGGTG ACTGGCTTTT TTTCGTGTAC GACAGAAACC AGAACGATGT AATTGAAGTG AACCAGACCA ACTATGAAAC  CTGCAATGCC GAGCATCCAA TTCACAATTA CACAACAGGA GCCGGAAGAG ACGTAGTGGC ACTCAATGTC ACCCATGACC GCTACTTCAT TAGTAGCAAA GGGGCGTGCT ACGGTGGCAT  GAAACTTCAC GTACATCTCA GTCCGCTACC ACCACCACCA AAATCCGCGC CTGCAAAGAG TCACTCTTCA AGATTCACCG TCCTTAGAAG CCAGCTCGTG ATCCCTGCTG TCCTCGCTGT  TGCCGCAATA TGGGACTCGC TACTTCTTCG TGTTTGATGC AAAGTTCATT TTGATGGCAG ATAGGTGTGG TACATTGGTG CTTGTTGTAT TGGGTTTTTT GATCTTTTTT CATTGGGTGT  TGAATTTGTT TTTTGTTCTT CATCATAGTT TGACCAAAAT TTTATTTATG GGTATGATTG TGTTGGGTAG ACGATGTAAT TGAACATTGA TTTTATATAT TCGATTATTA ATTTATTCAA  TCTATTGCGT GACTGGCGGA TTAAGCCATG ATTTATCCTT TGCACATGGT AGTGGTTGTG GGTCTTGTCA TCATACACAT GTGGTCTCTT TGACCCTGGC TGGAGATTAG GAGTGATTGG 
ATTTAAGTGT AGCAGAATCA AAGAATAAAA TGAGGCTTCA TCTAAATGAA CTCTCTTCTC TCTTTACTAG CTGTACCCCT TTGTGAGAGA AACTATTTCA AAT 

Retrieve as FASTA