Entry information : HaENODL07HanXRQChr09g0269831
Entry ID 14526
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL07HanXRQChr09g0269831
Name HaENODL07HanXRQChr09g0269831
Class Early nodulin    [Orthogroup: ENODL001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL07
start..stop
S start..stop
ThasENODL10 165 6e-53 5..170 6..171
AtENODL03 148 3e-46 7..127 8..129
AtENODL12 145 5e-45 1..124 1..127
AtENODL20 122 2e-36 33..158 24..141
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 187806709..187806886 178 N° 2 187806988..187807340 353  
join(187806709..187806886,187806988..187807340)


exon

Literature and cross-references HaENODL07HanXRQChr09g0269831
DNA ref. HanXRQ genome:   HanXRQChr09 (187806709..187807340)
Protein sequence: HaENODL07HanXRQChr09g0269831
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   176 (154)
PWM (Da):   %s   19657.72 (17219.3) Transmb domain:   %s   o158-175i
PI (pH):   %s   6.6 (6.07) Peptide Signal:   %s   cut: 23 range:23-176
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKNTTPILIAFAFLTILKLHTAHQFQVGGDKGWVIPPSNDTDHYNQWATHNRFSINDTLRFEYKKDSVLVVTKEEHEKCKSSHPLFFSDNGDTSFELNRSGFFYFISGDSGHCERGLKMIVKVLEAENNVGHPANHTSTTTTTTSEAASVLKMDSDTLSQTLMIVGIIAMFTVFYM

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAACACAACCCCCATTCTCATAGCATTCGCCTTCTTAACCATCCTCAAACTCCACACGGCTCATCAGTTCCAAGTTGGTGGCGACAAAGGCTGGGTCATCCCTCCCTCTAACGAC
ACCGATCACTACAACCAATGGGCTACCCACAATCGCTTTAGCATAAACGACACATTGC
GTAAGTACTTGTAATCTTTTCAAACCAAACATTAAGATTTTACAGCATGTTCTTAAAGTTGT
TAATTGTAATGTTGCATATTTGCATGCAATGTTGTGTAGGTTTTGAGTACAAGAAAGATTCGGTGTTGGTTGTGACCAAAGAAGAACACGAGAAATGCAAGTCATCGCACCCTTTATTCT
TCTCTGACAATGGTGACACTAGTTTTGAACTCAACCGGTCTGGATTCTTTTACTTTATTAGTGGTGATTCTGGTCATTGTGAACGTGGTCTTAAGATGATTGTTAAGGTTTTGGAAGCTG
AAAACAACGTTGGTCATCCTGCAAACCATACATCTACTACTACTACTACTACGAGTGAAGCGGCTTCGGTACTAAAGATGGATAGTGACACGTTGTCTCAAACTCTTATGATCGTAGGAA
TCATCGCGATGTTTACCGTCTTTTATATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAACACAACCCCCATTCTCATAGCATTCGCCTTCTTAACCATCCTCAAACTCCACACGGCTCATCAGTTCCAAGTTGGTGGCGACAAAGGCTGGGTCATCCCTCCCTCTAACGAC
ACCGATCACTACAACCAATGGGCTACCCACAATCGCTTTAGCATAAACGACACATTGC
GTTTTGAGTACAAGAAAGATTCGGTGTTGGTTGTGACCAAAGAAGAACACGAGAAATGCAAG
TCATCGCACCCTTTATTCTTCTCTGACAATGGTGACACTAGTTTTGAACTCAACCGGTCTGGATTCTTTTACTTTATTAGTGGTGATTCTGGTCATTGTGAACGTGGTCTTAAGATGATT
GTTAAGGTTTTGGAAGCTGAAAACAACGTTGGTCATCCTGCAAACCATACATCTACTACTACTACTACTACGAGTGAAGCGGCTTCGGTACTAAAGATGGATAGTGACACGTTGTCTCAA
ACTCTTATGATCGTAGGAATCATCGCGATGTTTACCGTCTTTTATATGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAAAA TTGTCACATG ATTCAAAATA ACCAATTTAC TTTCATGAAA TATCGTGGAA GAAAAAACAG AAGTTACCGA GTCAAAGATC GTATCCCCAC TTCTCCTCAA CCATCTCTCC  CACTCTCTTC AAAATAACCA ACTTCTTCGC ACCAAACCCT AATATATAAA CAACCCTAGG TTCTTCACTC CCCTTAATTA AACCACCATC AATCACTAAA CCATGAAGAA CACAACCCCC  ATTCTCATAG CATTCGCCTT CTTAACCATC CTCAAACTCC ACACGGCTCA TCAGTTCCAA GTTGGTGGCG ACAAAGGCTG GGTCATCCCT CCCTCTAACG ACACCGATCA CTACAACCAA  TGGGCTACCC ACAATCGCTT TAGCATAAAC GACACATTGC GTTTTGAGTA CAAGAAAGAT TCGGTGTTGG TTGTGACCAA AGAAGAACAC GAGAAATGCA AGTCATCGCA CCCTTTATTC  TTCTCTGACA ATGGTGACAC TAGTTTTGAA CTCAACCGGT CTGGATTCTT TTACTTTATT AGTGGTGATT CTGGTCATTG TGAACGTGGT CTTAAGATGA TTGTTAAGGT TTTGGAAGCT  GAAAACAACG TTGGTCATCC TGCAAACCAT ACATCTACTA CTACTACTAC TACGAGTGAA GCGGCTTCGG TACTAAAGAT GGATAGTGAC ACGTTGTCTC AAACTCTTAT GATCGTAGGA  ATCATCGCGA TGTTTACCGT CTTTTATATG TGATTTTGTT TTTGGAATTT GGATGTATTA GTTTCTAACT ACTTTAAGTA AGATTGTCTT CTTTTTTGTT GCAAAAATGG ATTGTTTGTA 
AGCTGGTTGC AAAAGT 

Retrieve as FASTA