Entry information : HaENODL08HanXRQChr09g0275921
Entry ID 14527
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL08HanXRQChr09g0275921
Name HaENODL08HanXRQChr09g0275921
Class Early nodulin    [Orthogroup: ENODL010]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL08
start..stop
S start..stop
HarENODL08 399 5e-145 1..194 1..194
HaENODL13 166 8e-53 9..189 14..193
HaENODL09 140 1e-41 1..124 9..133
AtENODL05 125 6e-37 7..135 14..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 205884526..205884700 175 N° 2 205884018..205884427 410  
complement(join(205884018..205884427,205884526..205884700))


exon

Literature and cross-references HaENODL08HanXRQChr09g0275921
DNA ref. HanXRQ genome:   HanXRQChr09 (205884700..205884018)
Protein sequence: HaENODL08HanXRQChr09g0275921
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194 (174)
PWM (Da):   %s   20748.43 (18571.2) Transmb domain:   %s   i5-27o170-192i
PI (pH):   %s   8.84 (8.84) Peptide Signal:   %s   cut: 21 range:21-194
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSHSIFIIFLFIAIATVTTAAKEYFVGNHVGWRIPPPNETEIYTIWASRRRFYIGDTLRFRYSASSVVQVDKYGFYHCDSTHPISFSVDGNTVVKLDKVGTVYFISGNSERCSKGQRMIVNVNNVRQHYPPAAHPPCNQYYSLAPSPSQGYGSGSGAGAGAGALLDSGSAVLASASVMALVVALAGLGLCLVEG

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCATTCCATATTCATTATATTCCTTTTCATTGCAATCGCGACAGTCACAACCGCCGCAAAAGAATACTTCGTCGGTAACCACGTCGGTTGGCGGATTCCCCCTCCTAACGAAACC
GAAATCTACACCATCTGGGCTTCACGAAGACGGTTTTACATCGGAGATACTCTTC
GTCAGTCTCATTATTATAATTATCATTCGTTAACTTTTCATATTCTAATGCTATTTTTTTTCATT
ATGTTTAACCGTTTTCATTATGTTTGTGATTAGGGTTTCGGTACAGTGCCAGTTCGGTTGTGCAGGTTGATAAATATGGGTTCTACCACTGTGATTCTACTCATCCAATATCGTTTTCTG
TTGATGGAAACACGGTTGTGAAACTTGACAAAGTGGGTACGGTTTATTTCATTAGTGGGAACTCAGAACGGTGTAGTAAAGGGCAAAGGATGATTGTGAATGTGAACAATGTGCGACAAC
ATTATCCGCCTGCGGCTCATCCGCCGTGTAACCAGTATTATTCTCTGGCACCTTCTCCTTCTCAGGGTTATGGTTCGGGTTCGGGTGCTGGTGCTGGTGCGGGTGCTTTGTTGGATTCTG
GTTCAGCTGTTTTGGCTTCGGCTTCGGTTATGGCTCTTGTTGTTGCTCTAGCAGGTCTTGGATTGTGCTTGGTGGAGGGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCATTCCATATTCATTATATTCCTTTTCATTGCAATCGCGACAGTCACAACCGCCGCAAAAGAATACTTCGTCGGTAACCACGTCGGTTGGCGGATTCCCCCTCCTAACGAAACC
GAAATCTACACCATCTGGGCTTCACGAAGACGGTTTTACATCGGAGATACTCTTC
GGTTTCGGTACAGTGCCAGTTCGGTTGTGCAGGTTGATAAATATGGGTTCTACCACTGTGATTCT
ACTCATCCAATATCGTTTTCTGTTGATGGAAACACGGTTGTGAAACTTGACAAAGTGGGTACGGTTTATTTCATTAGTGGGAACTCAGAACGGTGTAGTAAAGGGCAAAGGATGATTGTG
AATGTGAACAATGTGCGACAACATTATCCGCCTGCGGCTCATCCGCCGTGTAACCAGTATTATTCTCTGGCACCTTCTCCTTCTCAGGGTTATGGTTCGGGTTCGGGTGCTGGTGCTGGT
GCGGGTGCTTTGTTGGATTCTGGTTCAGCTGTTTTGGCTTCGGCTTCGGTTATGGCTCTTGTTGTTGCTCTAGCAGGTCTTGGATTGTGCTTGGTGGAGGGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGCAATCA CAAACACAAT CTCTTAAACC CTCATTACAT ACAACCTTCT GTTTTCTCTT CTTGCAAACA TAGCAAATCA AAATGTCTCA TTCCATATTC ATTATATTCC TTTTCATTGC  AATCGCGACA GTCACAACCG CCGCAAAAGA ATACTTCGTC GGTAACCACG TCGGTTGGCG GATTCCCCCT CCTAACGAAA CCGAAATCTA CACCATCTGG GCTTCACGAA GACGGTTTTA  CATCGGAGAT ACTCTTCGGT TTCGGTACAG TGCCAGTTCG GTTGTGCAGG TTGATAAATA TGGGTTCTAC CACTGTGATT CTACTCATCC AATATCGTTT TCTGTTGATG GAAACACGGT  TGTGAAACTT GACAAAGTGG GTACGGTTTA TTTCATTAGT GGGAACTCAG AACGGTGTAG TAAAGGGCAA AGGATGATTG TGAATGTGAA CAATGTGCGA CAACATTATC CGCCTGCGGC  TCATCCGCCG TGTAACCAGT ATTATTCTCT GGCACCTTCT CCTTCTCAGG GTTATGGTTC GGGTTCGGGT GCTGGTGCTG GTGCGGGTGC TTTGTTGGAT TCTGGTTCAG CTGTTTTGGC  TTCGGCTTCG GTTATGGCTC TTGTTGTTGC TCTAGCAGGT CTTGGATTGT GCTTGGTGGA GGGTTAGATT TGGTTTGGAT TTTGGGTTTA TGGTTATTTG AAGTTATGGT TTAATATTTT 
GGATTTTTGA TTGCTTTGTT TTTGTTTAAT TGATTTGGAT CTTTGATTTT TATATTTATC AACTAATTCA TTAGTT 

Retrieve as FASTA