Entry information : HaENODL09HanXRQChr10g0313591
Entry ID 14528
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL09HanXRQChr10g0313591
Name HaENODL09HanXRQChr10g0313591
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL09
start..stop
S start..stop
HaENODL13 156 2e-47 15..193 10..177
HarENODL08 132 3e-38 25..144 16..133
HaENODL08 132 3e-38 25..144 16..133
AtENODL05 105 9e-28 10..133 9..134
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 226572545..226572746 202 N° 2 226571769..226572451 683  
complement(join(226571769..226572451,226572545..226572746))


exon

Literature and cross-references HaENODL09HanXRQChr10g0313591
DNA ref. HanXRQ genome:   HanXRQChr10 (226572746..226571769)
Protein sequence: HaENODL09HanXRQChr10g0313591
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   294 (265)
PWM (Da):   %s   32497.37 (29196.7) Transmb domain:   %s   i13-35o
PI (pH):   %s   3.74 (3.74) Peptide Signal:   %s   cut: 30 range:30-294
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQPFYPQIMSSSLTIFFSIFFALISFVSAITEYTVGDDMGWRIPAANETELYNVWASRRRFYVGDSLRFRYTYDSLVIVDKFGFYHCDSSKAIRYYNEGDDVIVLYMPGCMYFTSGEAEECKQGLKMAVQVLNSGPKPEFPPPPTFNPPPPPPPPPTFDPPPPPTFDPPPPPPPTFDPPPPPTFNPPPPRIDPPPPTFDPPPPAFDPPDDPDPDYPDPGPDYPDPGQDYPNPGPDYPDPGPDYPDPGPDNPDPGMHPVPESSPAPSLSDSVISFVVFYFVTAFVVDFGLWDLEV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAACCCTTTTACCCACAAATAATGTCTTCATCTTTAACCATCTTCTTCTCCATCTTCTTCGCCCTCATTAGCTTCGTCTCCGCCATCACCGAATACACCGTCGGGGACGACATGGGA
TGGCGGATCCCCGCAGCCAACGAAACCGAACTCTACAACGTATGGGCATCCAGACGCCGGTTCTACGTCGGTGACTCTCTCC
GTCAGTTCCACTTCACCCTTTTCTAACAGTTTTATTCA
ATTTGGGATGATGTTAGTTATTTGATTATGTAATTTGTTTTGAATTAAACTGCAGGCTTTCGTTACACTTATGACTCACTGGTGATTGTTGACAAATTCGGGTTTTACCACTGCGATTCA
AGTAAGGCGATTCGTTATTATAACGAAGGTGATGACGTGATCGTTCTTTATATGCCGGGTTGTATGTATTTCACTAGTGGTGAGGCTGAAGAGTGTAAACAAGGGTTGAAGATGGCGGTT
CAAGTCTTGAATTCCGGCCCCAAACCGGAGTTTCCGCCTCCGCCCACATTCAATCCGCCTCCCCCGCCGCCTCCGCCTCCCACATTTGATCCGCCTCCGCCGCCCACGTTTGATCCGCCT
CCGCCTCCACCGCCCACGTTTGATCCGCCTCCCCCGCCTACGTTCAATCCTCCACCGCCTAGGATTGATCCGCCTCCGCCCACATTCGATCCTCCTCCGCCCGCATTTGATCCGCCTGAT
GATCCGGATCCGGATTATCCTGACCCTGGACCGGATTACCCTGACCCTGGTCAAGATTACCCCAATCCTGGACCGGATTACCCGGATCCTGGGCCGGATTACCCGGATCCTGGGCCGGAT
AATCCTGATCCGGGCATGCATCCGGTGCCGGAATCGAGTCCGGCACCTTCTCTGTCAGATTCAGTTATATCATTTGTGGTTTTTTATTTTGTAACTGCTTTTGTTGTTGATTTTGGGTTG
TGGGATTTGGAGGTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAACCCTTTTACCCACAAATAATGTCTTCATCTTTAACCATCTTCTTCTCCATCTTCTTCGCCCTCATTAGCTTCGTCTCCGCCATCACCGAATACACCGTCGGGGACGACATGGGA
TGGCGGATCCCCGCAGCCAACGAAACCGAACTCTACAACGTATGGGCATCCAGACGCCGGTTCTACGTCGGTGACTCTCTCC
GCTTTCGTTACACTTATGACTCACTGGTGATTGTTGAC
AAATTCGGGTTTTACCACTGCGATTCAAGTAAGGCGATTCGTTATTATAACGAAGGTGATGACGTGATCGTTCTTTATATGCCGGGTTGTATGTATTTCACTAGTGGTGAGGCTGAAGAG
TGTAAACAAGGGTTGAAGATGGCGGTTCAAGTCTTGAATTCCGGCCCCAAACCGGAGTTTCCGCCTCCGCCCACATTCAATCCGCCTCCCCCGCCGCCTCCGCCTCCCACATTTGATCCG
CCTCCGCCGCCCACGTTTGATCCGCCTCCGCCTCCACCGCCCACGTTTGATCCGCCTCCCCCGCCTACGTTCAATCCTCCACCGCCTAGGATTGATCCGCCTCCGCCCACATTCGATCCT
CCTCCGCCCGCATTTGATCCGCCTGATGATCCGGATCCGGATTATCCTGACCCTGGACCGGATTACCCTGACCCTGGTCAAGATTACCCCAATCCTGGACCGGATTACCCGGATCCTGGG
CCGGATTACCCGGATCCTGGGCCGGATAATCCTGATCCGGGCATGCATCCGGTGCCGGAATCGAGTCCGGCACCTTCTCTGTCAGATTCAGTTATATCATTTGTGGTTTTTTATTTTGTA
ACTGCTTTTGTTGTTGATTTTGGGTTGTGGGATTTGGAGGTATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCACTCCAT GCAACCCTTT TACCCACAAA TAATGTCTTC ATCTTTAACC ATCTTCTTCT CCATCTTCTT CGCCCTCATT AGCTTCGTCT CCGCCATCAC CGAATACACC GTCGGGGACG  ACATGGGATG GCGGATCCCC GCAGCCAACG AAACCGAACT CTACAACGTA TGGGCATCCA GACGCCGGTT CTACGTCGGT GACTCTCTCC GCTTTCGTTA CACTTATGAC TCACTGGTGA  TTGTTGACAA ATTCGGGTTT TACCACTGCG ATTCAAGTAA GGCGATTCGT TATTATAACG AAGGTGATGA CGTGATCGTT CTTTATATGC CGGGTTGTAT GTATTTCACT AGTGGTGAGG  CTGAAGAGTG TAAACAAGGG TTGAAGATGG CGGTTCAAGT CTTGAATTCC GGCCCCAAAC CGGAGTTTCC GCCTCCGCCC ACATTCAATC CGCCTCCCCC GCCGCCTCCG CCTCCCACAT  TTGATCCGCC TCCGCCGCCC ACGTTTGATC CGCCTCCGCC TCCACCGCCC ACGTTTGATC CGCCTCCCCC GCCTACGTTC AATCCTCCAC CGCCTAGGAT TGATCCGCCT CCGCCCACAT  TCGATCCTCC TCCGCCCGCA TTTGATCCGC CTGATGATCC GGATCCGGAT TATCCTGACC CTGGACCGGA TTACCCTGAC CCTGGTCAAG ATTACCCCAA TCCTGGACCG GATTACCCGG  ATCCTGGGCC GGATTACCCG GATCCTGGGC CGGATAATCC TGATCCGGGC ATGCATCCGG TGCCGGAATC GAGTCCGGCA CCTTCTCTGT CAGATTCAGT TATATCATTT GTGGTTTTTT  ATTTTGTAAC TGCTTTTGTT GTTGATTTTG GGTTGTGGGA TTTGGAGGTA TAGGTGTTTT TAGTTTTTGG TTTTTTGTTA TGTGTTTATA ATTTGAATTC TTGGATTAAT TTTGAAGTGT 
AATATATTGT AAGTCGTGTA CCCGTTCTTG A 

Retrieve as FASTA