Entry information : HaENODL10HanXRQChr11g0328551
Entry ID 14529
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL10HanXRQChr11g0328551
Name HaENODL10HanXRQChr11g0328551
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL10
start..stop
S start..stop
HaENODL22 211 6e-67 3..168 21..176
HaENODL14 198 9e-61 4..134 6..136
HaENODL15 173 8e-52 6..126 19..141
AtENODL14 159 2e-45 4..354 8..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33239363..33239528 166 N° 2 33238842..33239270 429 N° 3 33237988..33238628 641  
complement(join(33237988..33238628,33238842..33239270,33239363..33239528))


exon

Literature and cross-references HaENODL10HanXRQChr11g0328551
DNA ref. HanXRQ genome:   HanXRQChr11 (33239528..33237988)
Protein sequence: HaENODL10HanXRQChr11g0328551
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   411 (390)
PWM (Da):   %s   37479.49 (35067.3) Transmb domain:   %s   o4-26i388-410o
PI (pH):   %s   6.78 (6.67) Peptide Signal:   %s   cut: 22 range:22-411
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLYIFLTVFFTVFCFSHANNFNVGGKDGWTLHPSESYSQWSSRLRFVINDNLHFKYDGGTDSVLEVSKGDYDGCNTNSPITKLTGGDSTFSLNRPGPFYFISGNKSNCVQGQKLTVVVITPKSTKTPPAVAPTPPGSPPGTSTPGSPGAPPGGGGGGSTSPPGSPGASPGGGGSSSPPGSPGASPGGGGGGSTHPGSPGSSPGGGGGGGGSTHPGSPEASPGGGGSTPGSPGASPGGGGGSSHPGSPEASPGGGGGLTPGSPGASPGGGGGASSPLGSPGASPSGGGISTSPAGSPTGSPGGGTSSPVGSPAGSPGGGALSPSGSPGASPGGGTSSPGGSPAASPGGAASTPMGNPADTPGGAPSSPTGNPADTNGNGNQNGSATSSGVCAILTMPIAMIIFMLGWAY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTCTCTACATTTTCCTCACTGTGTTCTTCACTGTGTTTTGTTTTTCACATGCAAATAACTTCAATGTTGGCGGGAAAGATGGGTGGACTCTGCACCCTTCTGAAAGCTAC
AGTCAATGGTCAAGCAGGTTGAGGTTTGTCATCAACGACAATCTCC
GTACGTAATTTTGTGTCTCTTTTTTGTGTTTTTGATATGGGTTTTTGGTTTTGTGAAATGGGTTGGTGAAAAGT
TTTGATTTTGAATTGCAGATTTTAAGTATGATGGTGGGACTGATTCTGTATTGGAGGTTAGCAAAGGCGATTATGATGGCTGCAACACGAATAGTCCTATTACTAAGCTTACTGGTGGAG
ATTCTACCTTTAGTTTGAACCGTCCTGGGCCGTTTTATTTTATCAGTGGTAATAAGTCGAATTGTGTTCAAGGTCAGAAGTTGACGGTGGTTGTTATTACGCCGAAATCGACGAAAACAC
CGCCTGCTGTTGCTCCAACTCCGCCCGGCTCGCCACCGGGAACATCCACACCAGGTAGTCCTGGTGCTCCTCCGGGCGGAGGTGGAGGTGGCTCAACTTCTCCACCAGGTAGTCCCGGAG
CCTCACCTGGTGGAGGAGGGTCATCATCTCCACCAGGTAGCCCTGGAGCATCACCTGGTGGTGGTGGAGGAGGCTCTACTCACCCAG
GTAGCCCCGGGTCATCACCTGGTGGTGGTGGGG
GAGGAGGAGGCTCTACTCACCCAGGTAGCCCTGGCGCTTCACCTGGTGGAGGTGGAGGTGGAGGTGGCTCAACCCCAGGTAGTCCCGGGGCCTCACCTGGCAGAGGAGGAGGGTCATCAT
CTCCACCAGGTAGCCCCGTAGCATCACCTGGTGGTGGTGGAGGAGGCTCTACTCACCCAGGTAGCCCCGGGTCATCACCTGGTGGTGGTGGGGGAGGAGGAGGCTCTACTCACCCAGGTA
GCCCTGAGGCTTCACCTGGTGGAGGTGGCTCAACCCCAGGTAGTCCCGGGGCATCACCTGGTGGAGGCGGCGGATCTTCTCACCCAGGTAGCCCCGAGGCTTCACCCGGTGGAGGAGGAG
GGTTAACCCCAGGTAGTCCCGGGGCATCACCTGGTGGAGGGGGAGGCGCATCTTCTCCACTAGGTAGTCCCGGAGCTTCACCAAGTGGAGGGGGTATCTCTACTTCTCCCGCTGGTAGTC
CAACGGGTTCACCAGGTGGTGGAACCTCCTCTCCTGTCGGTAGTCCAGCAGGTTCACCCGGTGGAGGAGCCCTATCTCCATCTGGTAGTCCAGGGGCTTCACCAGGTGGAGGCACCTCTT
CTCCTGGTGGAAGTCCAGCAGCTTCACCAGGTGGAGCCGCGTCTACTCCCATGGGTAATCCAGCGGATACTCCGGGCGGAGCTCCGTCTTCTCCAACTGGGAACCCGGCGGATACTAATG
GGAATGGAAACCAGAATGGATCGGCAACAAGTTCAGGTGTTTGTGCAATCTTGACTATGCCAATTGCCATGATAATATTTATGCTTGGGTGGGCTTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTCTCTACATTTTCCTCACTGTGTTCTTCACTGTGTTTTGTTTTTCACATGCAAATAACTTCAATGTTGGCGGGAAAGATGGGTGGACTCTGCACCCTTCTGAAAGCTAC
AGTCAATGGTCAAGCAGGTTGAGGTTTGTCATCAACGACAATCTCC
ATTTTAAGTATGATGGTGGGACTGATTCTGTATTGGAGGTTAGCAAAGGCGATTATGATGGCTGCAACACGAAT
AGTCCTATTACTAAGCTTACTGGTGGAGATTCTACCTTTAGTTTGAACCGTCCTGGGCCGTTTTATTTTATCAGTGGTAATAAGTCGAATTGTGTTCAAGGTCAGAAGTTGACGGTGGTT
GTTATTACGCCGAAATCGACGAAAACACCGCCTGCTGTTGCTCCAACTCCGCCCGGCTCGCCACCGGGAACATCCACACCAGGTAGTCCTGGTGCTCCTCCGGGCGGAGGTGGAGGTGGC
TCAACTTCTCCACCAGGTAGTCCCGGAGCCTCACCTGGTGGAGGAGGGTCATCATCTCCACCAGGTAGCCCTGGAGCATCACCTGGTGGTGGTGGAGGAGGCTCTACTCACCCAG
GTAGC
CCCGGGTCATCACCTGGTGGTGGTGGGGGAGGAGGAGGCTCTACTCACCCAGGTAGCCCTGAGGCTTCACCTGGTGGAGGTGGCTCAACCCCAGGTAGTCCCGGGGCATCACCTGGTGGA
GGCGGCGGATCTTCTCACCCAGGTAGCCCCGAGGCTTCACCCGGTGGAGGAGGAGGGTTAACCCCAGGTAGTCCCGGGGCATCACCTGGTGGAGGGGGAGGCGCATCTTCTCCACTAGGT
AGTCCCGGAGCTTCACCAAGTGGAGGGGGTATCTCTACTTCTCCCGCTGGTAGTCCAACGGGTTCACCAGGTGGTGGAACCTCCTCTCCTGTCGGTAGTCCAGCAGGTTCACCCGGTGGA
GGAGCCCTATCTCCATCTGGTAGTCCAGGGGCTTCACCAGGTGGAGGCACCTCTTCTCCTGGTGGAAGTCCAGCAGCTTCACCAGGTGGAGCCGCGTCTACTCCCATGGGTAATCCAGCG
GATACTCCGGGCGGAGCTCCGTCTTCTCCAACTGGGAACCCGGCGGATACTAATGGGAATGGAAACCAGAATGGATCGGCAACAAGTTCAGGTGTTTGTGCAATCTTGACTATGCCAATT
GCCATGATAATATTTATGCTTGGGTGGGCTTATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAATAATAC CCTTTATACG TTTGCAATCA GTTATCCTTT CAAAAATCTA TATCCAACCG TTAACTTACT GTAGATTTGC CACGTGGCAA ACTCCTTCAT CACCAGATTT CCGCATATTT  CCTCTGCAAC CGCATATTTC CTCTGCAATC TTCCATTTAT CATCTTCTAG CACCTTCACT CACCCCTTCA ATGGCTTCCT CTCTCTACAT TTTCCTCACT GTGTTCTTCA CTGTGTTTTG  TTTTTCACAT GCAAATAACT TCAATGTTGG CGGGAAAGAT GGGTGGACTC TGCACCCTTC TGAAAGCTAC AGTCAATGGT CAAGCAGGTT GAGGTTTGTC ATCAACGACA ATCTCCATTT  TAAGTATGAT GGTGGGACTG ATTCTGTATT GGAGGTTAGC AAAGGCGATT ATGATGGCTG CAACACGAAT AGTCCTATTA CTAAGCTTAC TGGTGGAGAT TCTACCTTTA GTTTGAACCG  TCCTGGGCCG TTTTATTTTA TCAGTGGTAA TAAGTCGAAT TGTGTTCAAG GTCAGAAGTT GACGGTGGTT GTTATTACGC CGAAATCGAC GAAAACACCG CCTGCTGTTG CTCCAACTCC  GCCCGGCTCG CCACCGGGAA CATCCACACC AGGTAGTCCT GGTGCTCCTC CGGGCGGAGG TGGAGGTGGC TCAACTTCTC CACCAGGTAG TCCCGGAGCC TCACCTGGTG GAGGAGGGTC  ATCATCTCCA CCAGGTAGCC CTGGAGCATC ACCTGGTGGT GGTGGAGGAG GCTCTACTCA CCCAGGTAGC CCCGGGTCAT CACCTGGTGG TGGTGGGGGA GGAGGAGGCT CTACTCACCC  AGGTAGCCCT GAGGCTTCAC CTGGTGGAGG TGGCTCAACC CCAGGTAGTC CCGGGGCATC ACCTGGTGGA GGCGGCGGAT CTTCTCACCC AGGTAGCCCC GAGGCTTCAC CCGGTGGAGG  AGGAGGGTTA ACCCCAGGTA GTCCCGGGGC ATCACCTGGT GGAGGGGGAG GCGCATCTTC TCCACTAGGT AGTCCCGGAG CTTCACCAAG TGGAGGGGGT ATCTCTACTT CTCCCGCTGG  TAGTCCAACG GGTTCACCAG GTGGTGGAAC CTCCTCTCCT GTCGGTAGTC CAGCAGGTTC ACCCGGTGGA GGAGCCCTAT CTCCATCTGG TAGTCCAGGG GCTTCACCAG GTGGAGGCAC  CTCTTCTCCT GGTGGAAGTC CAGCAGCTTC ACCAGGTGGA GCCGCGTCTA CTCCCATGGG TAATCCAGCG GATACTCCGG GCGGAGCTCC GTCTTCTCCA ACTGGGAACC CGGCGGATAC  TAATGGGAAT GGAAACCAGA ATGGATCGGC AACAAGTTCA GGTGTTTGTG CAATCTTGAC TATGCCAATT GCCATGATAA TATTTATGCT TGGGTGGGCT TATTAATTTG TTTAGGGAAA  TTATGTATTA GTTGTAATTT CTCACAAAAT TTGTTGTATT TTCGTAGTTG TTTGTGTTAA TAAATCGTTG GATTACCTCC ATTTCTAATT AAATGCATGT TGTATTTTTA CCCGCGATCT 
CAATACAATC CAACAAATCC CATAAGTGGT ATTAAATTCA TCCTTTTGAC ATGATATTCA TTGTAAAATG TCAGATCATA CCGTTCAAAA AAATATCAGA TTTAGTTTC 

Retrieve as FASTA