Entry information : HaENODL13HanXRQChr12g0360881
Entry ID 14532
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL13HanXRQChr12g0360881
Name HaENODL13HanXRQChr12g0360881
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL13
start..stop
S start..stop
HarENODL08 150 2e-46 24..154 18..145
HaENODL08 150 2e-46 24..154 18..145
HaENODL09 150 3e-45 5..133 10..136
ThasENODL15 129 3e-38 4..129 2..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19999817..20000009 193 N° 2 19999338..19999735 398  
complement(join(19999338..19999735,19999817..20000009))


exon

Literature and cross-references HaENODL13HanXRQChr12g0360881
DNA ref. HanXRQ genome:   HanXRQChr12 (20000009..19999338)
Protein sequence: HaENODL13HanXRQChr12g0360881
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196 (169)
PWM (Da):   %s   20964.21 (18106.7) Transmb domain:   %s   i9-28o
PI (pH):   %s   4.44 (4.33) Peptide Signal:   %s   cut: 28 range:28-196
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTSSRSPLLYSFIFTIAVVITTISATEFQVGGTVGWRIPATNESQLYNVWASRRRFHIGDSLHFRYKNDSVTVVEKWGFYHCDSSNPIAFFNDGDTVIDLNNIGTMYFISGDSDRCKQGVSMMVEVMSPVPVRYFPPAISAPPEGSFSDVAPSPAQVMSSGDEPEASPGPDTSDSVSVSGIAVVLGLGFGVLSL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCACTTCTTCACGCTCACCTCTCCTCTACTCCTTCATCTTCACCATCGCCGTCGTCATAACCACCATCTCCGCCACCGAGTTCCAAGTCGGCGGCACCGTCGGCTGGCGTATT
CCGGCCACCAACGAATCCCAACTCTACAACGTCTGGGCTTCCCGACGCCGCTTCCACATCGGCGATTCTCTCC
GTAAGTTCAATTTTTTTTCACCAATTTTAAACTCATCATCATTTAAT
AATTATTTACTTGTATTTTTTTGTTTTTTTACAGATTTTCGTTACAAGAACGATTCTGTTACAGTGGTTGAAAAATGGGGGTTCTACCACTGCGATTCAAGCAATCCGATCGCGTTCTTC
AACGACGGTGATACGGTTATCGACCTCAATAACATTGGGACGATGTATTTCATTAGTGGTGATTCTGATCGGTGTAAACAAGGTGTGAGTATGATGGTTGAGGTTATGAGTCCGGTGCCG
GTTAGGTACTTTCCGCCTGCTATTTCTGCTCCGCCGGAGGGTTCTTTTTCTGATGTGGCTCCGTCTCCGGCCCAGGTTATGAGTTCTGGTGATGAGCCGGAGGCTAGTCCTGGACCTGAT
ACGTCGGATTCGGTTTCGGTTTCTGGAATTGCGGTTGTTTTAGGGTTAGGGTTTGGTGTTTTGAGTCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCACTTCTTCACGCTCACCTCTCCTCTACTCCTTCATCTTCACCATCGCCGTCGTCATAACCACCATCTCCGCCACCGAGTTCCAAGTCGGCGGCACCGTCGGCTGGCGTATT
CCGGCCACCAACGAATCCCAACTCTACAACGTCTGGGCTTCCCGACGCCGCTTCCACATCGGCGATTCTCTCC
ATTTTCGTTACAAGAACGATTCTGTTACAGTGGTTGAAAAATGGGGG
TTCTACCACTGCGATTCAAGCAATCCGATCGCGTTCTTCAACGACGGTGATACGGTTATCGACCTCAATAACATTGGGACGATGTATTTCATTAGTGGTGATTCTGATCGGTGTAAACAA
GGTGTGAGTATGATGGTTGAGGTTATGAGTCCGGTGCCGGTTAGGTACTTTCCGCCTGCTATTTCTGCTCCGCCGGAGGGTTCTTTTTCTGATGTGGCTCCGTCTCCGGCCCAGGTTATG
AGTTCTGGTGATGAGCCGGAGGCTAGTCCTGGACCTGATACGTCGGATTCGGTTTCGGTTTCTGGAATTGCGGTTGTTTTAGGGTTAGGGTTTGGTGTTTTGAGTCTGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCATCGCCA CCACAACAAC CACTGTTATT CACTTCAAAC ATTCCACACA CACACACAGA AAAAAAAAAT GGCTTCCACT TCTTCACGCT CACCTCTCCT CTACTCCTTC ATCTTCACCA  TCGCCGTCGT CATAACCACC ATCTCCGCCA CCGAGTTCCA AGTCGGCGGC ACCGTCGGCT GGCGTATTCC GGCCACCAAC GAATCCCAAC TCTACAACGT CTGGGCTTCC CGACGCCGCT  TCCACATCGG CGATTCTCTC CATTTTCGTT ACAAGAACGA TTCTGTTACA GTGGTTGAAA AATGGGGGTT CTACCACTGC GATTCAAGCA ATCCGATCGC GTTCTTCAAC GACGGTGATA  CGGTTATCGA CCTCAATAAC ATTGGGACGA TGTATTTCAT TAGTGGTGAT TCTGATCGGT GTAAACAAGG TGTGAGTATG ATGGTTGAGG TTATGAGTCC GGTGCCGGTT AGGTACTTTC  CGCCTGCTAT TTCTGCTCCG CCGGAGGGTT CTTTTTCTGA TGTGGCTCCG TCTCCGGCCC AGGTTATGAG TTCTGGTGAT GAGCCGGAGG CTAGTCCTGG ACCTGATACG TCGGATTCGG  TTTCGGTTTC TGGAATTGCG GTTGTTTTAG GGTTAGGGTT TGGTGTTTTG AGTCTGTAGG TTTTTTAGTT TATTTTTAGT TTTATGGTGA TTATGTTGCA TTTGGATTGA TTTGGTTTAG 
TTGAAGTGTT TTGTGATTTT GAAT 

Retrieve as FASTA