Entry information : HaENODL14HanXRQChr12g0364131
Entry ID 14533
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL14HanXRQChr12g0364131
Name HaENODL14HanXRQChr12g0364131
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL14
start..stop
S start..stop
HaENODL15 243 2e-80 2..164 12..175
HaENODL22 190 3e-60 2..150 18..165
HaENODL10 187 5e-57 6..124 4..122
AtENODL23 176 4e-53 2..227 3..196
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33050763..33050934 172 N° 2 33051117..33051877 761  
join(33050763..33050934,33051117..33051877)


exon

Literature and cross-references HaENODL14HanXRQChr12g0364131
DNA ref. HanXRQ genome:   HanXRQChr12 (33050763..33051877)
Protein sequence: HaENODL14HanXRQChr12g0364131
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310 (287)
PWM (Da):   %s   31381.54 (28756.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.08 (7.50) Peptide Signal:   %s   cut: 24 range:24-310
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFHKSICFLLLIFITFMSSSHAHTFQVGGKDGWTLHPSENYNSWSGRLRFLINDTLHFKYDDGSDSVLVVNKSDYDGCNVNNPITKLDGGDSSFKFDRSGPFYFITGNKSNCDQGQKLTVVVLALRKRSPPPSIATPPSSSTLPPSPVGSPVFPPSKSPVSPPSTAVSPVFPPYMSPVSPPSTAVSPVFPPSMSPVSPPTTAVSPVFPPSMSPISPPTAGSPKLSPFGTPSFSPPAPSPGGGSADSPAGESADSPAGGGSASPPGGGGMSPGGSPGANSTTPSSAATPPLFGITVTSLVTVTLGLSGLI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCACAAATCTATCTGTTTTTTATTATTAATCTTCATCACTTTCATGTCTTCTTCCCATGCACATACCTTCCAGGTTGGTGGTAAAGATGGCTGGACCTTACACCCTTCTGAA
AACTACAACAGCTGGTCCGGCCGATTGCGGTTTCTGATCAACGATACCCTGC
GTACGTCGACTTTTCGTGCTAGATATTGTTTTGTTTAGATTCCATGAGAAGCACTCTATGTTTTTAAC
GTGTTTTTTATGTTCTGGTTTTGGACTGTACCAGTAGCTTAGCTATGGGTGGGATTTTACTGCGGCTGCTGCTTTGGGAATTTTATTAATGATTTGTGATTTGATTGTGTGCAGATTTTA
AGTATGATGATGGGTCGGATTCTGTTTTGGTGGTGAACAAAAGTGATTATGATGGATGCAATGTTAATAATCCGATCACTAAGCTGGATGGGGGTGATTCGTCGTTTAAGTTTGATCGAT
CGGGACCATTTTACTTCATTACGGGTAATAAATCGAATTGTGATCAAGGTCAGAAGCTAACTGTGGTGGTTTTGGCGCTTAGAAAGCGATCTCCACCTCCATCCATCGCTACTCCGCCTT
CATCGTCGACTTTACCACCGTCTCCGGTTGGTTCCCCTGTCTTTCCACCGTCTAAATCCCCTGTTTCACCACCTTCGACCGCGGTATCCCCTGTTTTTCCACCATATATGTCCCCAGTTT
CGCCACCTTCGACAGCGGTATCCCCTGTTTTTCCACCATCTATGTCCCCAGTTTCGCCACCTACGACCGCGGTATCCCCTGTTTTTCCACCATCCATGTCTCCTATTTCACCACCGACCG
CAGGGTCCCCTAAGTTATCACCTTTCGGAACTCCTTCCTTCAGTCCACCAGCGCCTTCCCCTGGTGGGGGAAGTGCGGATTCTCCTGCAGGAGAGAGTGCAGATTCCCCTGCTGGAGGAG
GGAGTGCATCTCCTCCAGGTGGTGGTGGAATGTCCCCGGGTGGTAGTCCGGGGGCAAACTCGACTACACCATCGTCAGCCGCAACGCCACCACTCTTTGGTATCACCGTTACATCACTTG
TAACGGTGACGTTAGGTTTATCGGGGCTTATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCACAAATCTATCTGTTTTTTATTATTAATCTTCATCACTTTCATGTCTTCTTCCCATGCACATACCTTCCAGGTTGGTGGTAAAGATGGCTGGACCTTACACCCTTCTGAA
AACTACAACAGCTGGTCCGGCCGATTGCGGTTTCTGATCAACGATACCCTGC
ATTTTAAGTATGATGATGGGTCGGATTCTGTTTTGGTGGTGAACAAAAGTGATTATGATGGATGCAAT
GTTAATAATCCGATCACTAAGCTGGATGGGGGTGATTCGTCGTTTAAGTTTGATCGATCGGGACCATTTTACTTCATTACGGGTAATAAATCGAATTGTGATCAAGGTCAGAAGCTAACT
GTGGTGGTTTTGGCGCTTAGAAAGCGATCTCCACCTCCATCCATCGCTACTCCGCCTTCATCGTCGACTTTACCACCGTCTCCGGTTGGTTCCCCTGTCTTTCCACCGTCTAAATCCCCT
GTTTCACCACCTTCGACCGCGGTATCCCCTGTTTTTCCACCATATATGTCCCCAGTTTCGCCACCTTCGACAGCGGTATCCCCTGTTTTTCCACCATCTATGTCCCCAGTTTCGCCACCT
ACGACCGCGGTATCCCCTGTTTTTCCACCATCCATGTCTCCTATTTCACCACCGACCGCAGGGTCCCCTAAGTTATCACCTTTCGGAACTCCTTCCTTCAGTCCACCAGCGCCTTCCCCT
GGTGGGGGAAGTGCGGATTCTCCTGCAGGAGAGAGTGCAGATTCCCCTGCTGGAGGAGGGAGTGCATCTCCTCCAGGTGGTGGTGGAATGTCCCCGGGTGGTAGTCCGGGGGCAAACTCG
ACTACACCATCGTCAGCCGCAACGCCACCACTCTTTGGTATCACCGTTACATCACTTGTAACGGTGACGTTAGGTTTATCGGGGCTTATTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAACTGATC TTCCTTAACT TTGAGGATTA CAATAACAAC CTAGGTGTCG GTAGCCGGTA GGGGACTGCC CCAATTCTTA GTCTACGTAA TAAATATCGT GACATCAAAG TTGGTACGTT  TTTGCCGCGT GTAAACAGCG TACGTATCTT GTTCTCTTTT TATAGCTAGG AAACATATCT CCTTTTTGAC TCATGAATTT TCTCATCAAT CATGGCGTTT CACAAATCTA TCTGTTTTTT  ATTATTAATC TTCATCACTT TCATGTCTTC TTCCCATGCA CATACCTTCC AGGTTGGTGG TAAAGATGGC TGGACCTTAC ACCCTTCTGA AAACTACAAC AGCTGGTCCG GCCGATTGCG  GTTTCTGATC AACGATACCC TGCATTTTAA GTATGATGAT GGGTCGGATT CTGTTTTGGT GGTGAACAAA AGTGATTATG ATGGATGCAA TGTTAATAAT CCGATCACTA AGCTGGATGG  GGGTGATTCG TCGTTTAAGT TTGATCGATC GGGACCATTT TACTTCATTA CGGGTAATAA ATCGAATTGT GATCAAGGTC AGAAGCTAAC TGTGGTGGTT TTGGCGCTTA GAAAGCGATC  TCCACCTCCA TCCATCGCTA CTCCGCCTTC ATCGTCGACT TTACCACCGT CTCCGGTTGG TTCCCCTGTC TTTCCACCGT CTAAATCCCC TGTTTCACCA CCTTCGACCG CGGTATCCCC  TGTTTTTCCA CCATATATGT CCCCAGTTTC GCCACCTTCG ACAGCGGTAT CCCCTGTTTT TCCACCATCT ATGTCCCCAG TTTCGCCACC TACGACCGCG GTATCCCCTG TTTTTCCACC  ATCCATGTCT CCTATTTCAC CACCGACCGC AGGGTCCCCT AAGTTATCAC CTTTCGGAAC TCCTTCCTTC AGTCCACCAG CGCCTTCCCC TGGTGGGGGA AGTGCGGATT CTCCTGCAGG  AGAGAGTGCA GATTCCCCTG CTGGAGGAGG GAGTGCATCT CCTCCAGGTG GTGGTGGAAT GTCCCCGGGT GGTAGTCCGG GGGCAAACTC GACTACACCA TCGTCAGCCG CAACGCCACC  ACTCTTTGGT ATCACCGTTA CATCACTTGT AACGGTGACG TTAGGTTTAT CGGGGCTTAT TTAGTTATTT GAAATAGATA ATTGAAGGGT TTGATTATAT AGAAATGTTA GGGTTTTTTG  TTTGTTGGAT TGATATATAG GTAGTTGAAT GTCAATAAAC GAGTGTACAT CATATGTTTC ATGTATGCAT AGCATGTATC TACATAAATA CTTGGTTGAA TAAATTTTTA TAATCATATT 
GTTTATTAAT ATTATTATTT ATA 

Retrieve as FASTA