Entry information : HaENODL16HanXRQChr13g0390601
Entry ID 14535
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL16HanXRQChr13g0390601
Name HaENODL16HanXRQChr13g0390601
Class Early nodulin    [Orthogroup: ENODL009]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL16
start..stop
S start..stop
HaENODL12 245 3e-84 1..181 1..180
ThasENODL08 135 8e-41 26..150 29..156
ThasENODL05 132 8e-40 26..159 23..150
ThasENODL06 130 3e-39 26..160 19..148
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27574684..27574873 190 N° 2 27575440..27575822 383  
join(27574684..27574873,27575440..27575822)


exon

Literature and cross-references HaENODL16HanXRQChr13g0390601
DNA ref. HanXRQ genome:   HanXRQChr13 (27574684..27575822)
Protein sequence: HaENODL16HanXRQChr13g0390601
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190 (166)
PWM (Da):   %s   20866.57 (18255.4)  
PI (pH):   %s   8.63 (8.84) Peptide Signal:   %s   cut: 25 range:25-190
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSSRFFMLCFIAGLVSFSMNVDAHEPKEFLVGGKENSWRIPTTPNVLNEWAEKQRFKVGDVLVFKYDSKTDSVLIVEEGDYKKCNKMKPIQQYNDGITRIKIVESGAFFFISGANGHCEKGEKLEVKVLSHKHSSPPPSLPPKSSPSMVPPPAQTPAESPNSSAVAPNVRIIGVSTMIMAIWTCFMIVF

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCGAGCAGATTTTTTATGTTGTGTTTCATAGCGGGTTTGGTTTCGTTTTCGATGAATGTTGATGCGCATGAACCAAAAGAGTTTTTGGTTGGTGGAAAAGAGAACTCGTGGCGT
ATCCCAACAACTCCTAATGTGTTAAATGAATGGGCTGAAAAACAGCGGTTTAAAGTCGGAGATGTGCTAG
GTAATTTTCTTTTGGTTTCTAGGGATGTTCTTCGGGTTATTTTTTCGGGT
TTCCGGGTCGGGTTGTTGGCTAGAAAATAAATGACCCGATTACTGACCTTCAAAGTTTGGGTTGTTCGGTTTTCGGGTGTAGATGTAAAAGGAAAAAAAAATTCACAAAATATCATCAAA
TATATTATGTTGTTAACAAAATATCATCACAATTCAAATATCATTTAACAGTATGGTATGATAATATTCAAAAGTCTCAAAACTTAATGTTTCAAATACAAAACACTCCAAATCAAATCG
CATTTATAAAAAAAAAAAATTAATGTTCGGGTTTTATTCGTTTTTCGGTTTAGGTTGTTCGGGTTTATGGTTGGGAAAAATTGACCCGATAACCGAACCATTTAAGGTTCAGGTTTTTAG
GTTATTATCTAACTTGGGTTCAAATTGTTTGATTTCAGATACCTAGAGAACGAAACCTAACAACATTGTTATATTCAACTTATAATATGTTACGTTTATATTATCTAGTTGGTTTTCAAT
ACAAGATAACTTACATAATTTTCATGTGAAATTTAGTGTTTAAATACGATTCGAAGACGGATTCAGTGTTGATTGTGGAGGAAGGAGACTATAAAAAATGTAACAAGATGAAGCCGATCC
AGCAATACAACGACGGCATCACCAGGATTAAGATTGTCGAATCGGGAGCATTCTTCTTCATTAGCGGCGCTAATGGACATTGTGAGAAGGGTGAAAAACTCGAGGTTAAGGTTTTGTCTC
ACAAACATAGCTCTCCCCCGCCGTCTCTACCTCCTAAAAGTTCGCCGAGTATGGTTCCTCCACCCGCACAAACTCCAGCCGAATCTCCAAACTCTAGCGCGGTCGCACCAAATGTCAGGA
TCATTGGTGTTTCCACCATGATTATGGCTATTTGGACTTGTTTTATGATTGTTTTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCGAGCAGATTTTTTATGTTGTGTTTCATAGCGGGTTTGGTTTCGTTTTCGATGAATGTTGATGCGCATGAACCAAAAGAGTTTTTGGTTGGTGGAAAAGAGAACTCGTGGCGT
ATCCCAACAACTCCTAATGTGTTAAATGAATGGGCTGAAAAACAGCGGTTTAAAGTCGGAGATGTGCTAG
TGTTTAAATACGATTCGAAGACGGATTCAGTGTTGATTGTGGAGGAAGGA
GACTATAAAAAATGTAACAAGATGAAGCCGATCCAGCAATACAACGACGGCATCACCAGGATTAAGATTGTCGAATCGGGAGCATTCTTCTTCATTAGCGGCGCTAATGGACATTGTGAG
AAGGGTGAAAAACTCGAGGTTAAGGTTTTGTCTCACAAACATAGCTCTCCCCCGCCGTCTCTACCTCCTAAAAGTTCGCCGAGTATGGTTCCTCCACCCGCACAAACTCCAGCCGAATCT
CCAAACTCTAGCGCGGTCGCACCAAATGTCAGGATCATTGGTGTTTCCACCATGATTATGGCTATTTGGACTTGTTTTATGATTGTTTTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCGA GCAGATTTTT TATGTTGTGT TTCATAGCGG GTTTGGTTTC GTTTTCGATG AATGTTGATG CGCATGAACC AAAAGAGTTT TTGGTTGGTG GAAAAGAGAA CTCGTGGCGT  ATCCCAACAA CTCCTAATGT GTTAAATGAA TGGGCTGAAA AACAGCGGTT TAAAGTCGGA GATGTGCTAG TGTTTAAATA CGATTCGAAG ACGGATTCAG TGTTGATTGT GGAGGAAGGA  GACTATAAAA AATGTAACAA GATGAAGCCG ATCCAGCAAT ACAACGACGG CATCACCAGG ATTAAGATTG TCGAATCGGG AGCATTCTTC TTCATTAGCG GCGCTAATGG ACATTGTGAG  AAGGGTGAAA AACTCGAGGT TAAGGTTTTG TCTCACAAAC ATAGCTCTCC CCCGCCGTCT CTACCTCCTA AAAGTTCGCC GAGTATGGTT CCTCCACCCG CACAAACTCC AGCCGAATCT 
CCAAACTCTA GCGCGGTCGC ACCAAATGTC AGGATCATTG GTGTTTCCAC CATGATTATG GCTATTTGGA CTTGTTTTAT GATTGTTTTT TAA 

Retrieve as FASTA