Entry information : HaENODL17HanXRQChr13g0407691
Entry ID 14536
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL17HanXRQChr13g0407691
Name HaENODL17HanXRQChr13g0407691
Class Early nodulin    [Orthogroup: ENODL008]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL17
start..stop
S start..stop
HarENODL17 433 1e-157 1..214 1..214
HaENODL11 193 3e-63 16..210 18..183
HaENODL03 170 3e-54 4..126 17..136
AtENODL13 151 1e-46 1..185 9..178
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 119271861..119272023 163 N° 2 119272549..119273030 482  
join(119271861..119272023,119272549..119273030)


exon

Literature and cross-references HaENODL17HanXRQChr13g0407691
DNA ref. HanXRQ genome:   HanXRQChr13 (119271861..119273030)
Protein sequence: HaENODL17HanXRQChr13g0407691
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214 (194)
PWM (Da):   %s   22548.89 (20364.7)  
PI (pH):   %s   4.52 (4.52) Peptide Signal:   %s   cut: 21 range:21-214
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTLLGLFSLFLTTIQTGYAYQFKVGGSGDWSLAASSSYDQWAQKGRFQTGDTVLFNYQANEDSVLQVTEADYKNCSTASPIAKYSDGHTMITLNQSGPHYFISGVVDHCKNHEKVVIIVLADRSNHTSDTPSPSPSASPPLPASPPTLPPAPTSEQFASPPPAPSAPEPDLNPAPTPAHSDENPPPSPTPSGASSTVMDLFCFFGALGGFFLL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACCCTTCTAGGGCTTTTTAGTCTTTTCCTGACGACGATTCAAACCGGCTATGCATACCAGTTCAAGGTTGGTGGTTCCGGTGACTGGAGCCTTGCAGCATCATCCTCCTATGAT
CAATGGGCGCAAAAAGGCCGGTTTCAAACGGGAGACACCGTTT
GTAAGTTTTATTATCATGTTATTTGCATCAAAAGTTTTGTGACAAATTTAAATCAAACTTTTTTTTCTTATTTTACA
TTGTTTGTGACAGTTTTGCCACAGAATTGAAACACTCACATTTTTTACGACTATTTTATGACCGGATTGAAACCGTCGCAAAATTTTCAACCAACTCTCCACCGACATTTAAAACTCAAC
TTAAAACTAATATTTTTGTGACCGTATTTGAACAGTGATAACTTTTGTATTAAGACTTGATTTATAATTTGTTTTCCATTTTTCTGCAACCGAAATGAAACATTCACAAATTTTGCGACT
TGTTTGTAACCGAATTCTAGCGGGTGCAAAATATTGCTGGATGTCAATACTTGTGCAAGCGTTGTGATTTCTGTCGCTAAATTTACAACTTATAATTGTGCGACCGATATGACTTCTGTC
ACTAAATTTACAACTTTTTTTACGGTCACAAATGCCCATCTGGTAGTAGTGTAACATATACTTGATAGGTTTTTTTGTTTGTATATAGTATTTAACTACCAGGCTAATGAGGACTCAGTG
CTCCAAGTAACCGAAGCCGACTACAAGAACTGCAGCACAGCCTCACCGATTGCAAAATACAGTGACGGCCACACTATGATCACGCTAAACCAATCCGGGCCTCATTATTTCATCAGTGGG
GTTGTAGATCACTGCAAAAACCATGAGAAAGTGGTGATTATCGTATTGGCAGACCGAAGCAACCACACTTCCGACACTCCATCTCCATCTCCGTCTGCATCTCCACCTCTACCTGCATCT
CCGCCAACTCTACCGCCAGCTCCCACCAGTGAACAGTTTGCCTCACCTCCACCCGCCCCAAGTGCACCAGAACCCGACCTCAATCCGGCCCCAACTCCAGCTCATTCGGACGAAAACCCT
CCACCATCTCCTACTCCAAGTGGTGCATCTTCAACGGTCATGGATCTCTTTTGCTTTTTTGGAGCTTTGGGTGGTTTCTTTCTTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACCCTTCTAGGGCTTTTTAGTCTTTTCCTGACGACGATTCAAACCGGCTATGCATACCAGTTCAAGGTTGGTGGTTCCGGTGACTGGAGCCTTGCAGCATCATCCTCCTATGAT
CAATGGGCGCAAAAAGGCCGGTTTCAAACGGGAGACACCGTTT
TATTTAACTACCAGGCTAATGAGGACTCAGTGCTCCAAGTAACCGAAGCCGACTACAAGAACTGCAGCACAGCCTCA
CCGATTGCAAAATACAGTGACGGCCACACTATGATCACGCTAAACCAATCCGGGCCTCATTATTTCATCAGTGGGGTTGTAGATCACTGCAAAAACCATGAGAAAGTGGTGATTATCGTA
TTGGCAGACCGAAGCAACCACACTTCCGACACTCCATCTCCATCTCCGTCTGCATCTCCACCTCTACCTGCATCTCCGCCAACTCTACCGCCAGCTCCCACCAGTGAACAGTTTGCCTCA
CCTCCACCCGCCCCAAGTGCACCAGAACCCGACCTCAATCCGGCCCCAACTCCAGCTCATTCGGACGAAAACCCTCCACCATCTCCTACTCCAAGTGGTGCATCTTCAACGGTCATGGAT
CTCTTTTGCTTTTTTGGAGCTTTGGGTGGTTTCTTTCTTCTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTCACTCTA CTCCTACAAA TACCCCTATA CTATGCCTTT CATGTTAAAC ATTCATTTAT CCTTCCCATT TTGCCCTTTT CTTTCTTGCT TTTGCAATGC TGACCCTTCT AGGGCTTTTT  AGTCTTTTCC TGACGACGAT TCAAACCGGC TATGCATACC AGTTCAAGGT TGGTGGTTCC GGTGACTGGA GCCTTGCAGC ATCATCCTCC TATGATCAAT GGGCGCAAAA AGGCCGGTTT  CAAACGGGAG ACACCGTTTT ATTTAACTAC CAGGCTAATG AGGACTCAGT GCTCCAAGTA ACCGAAGCCG ACTACAAGAA CTGCAGCACA GCCTCACCGA TTGCAAAATA CAGTGACGGC  CACACTATGA TCACGCTAAA CCAATCCGGG CCTCATTATT TCATCAGTGG GGTTGTAGAT CACTGCAAAA ACCATGAGAA AGTGGTGATT ATCGTATTGG CAGACCGAAG CAACCACACT  TCCGACACTC CATCTCCATC TCCGTCTGCA TCTCCACCTC TACCTGCATC TCCGCCAACT CTACCGCCAG CTCCCACCAG TGAACAGTTT GCCTCACCTC CACCCGCCCC AAGTGCACCA  GAACCCGACC TCAATCCGGC CCCAACTCCA GCTCATTCGG ACGAAAACCC TCCACCATCT CCTACTCCAA GTGGTGCATC TTCAACGGTC ATGGATCTCT TTTGCTTTTT TGGAGCTTTG  GGTGGTTTCT TTCTTCTTTA AGATTTTTGA GTTTGTTGTG TTTATTATCC ATACACTTTG TTAAATAAAT TCGTGGTAAT TGTGTTAAGC CGCTTGTGCG CGTTTGTGTG TATATATGTA 
TATGTATGTG AACAATATTT G 

Retrieve as FASTA