Entry information : HaENODL18HanXRQChr14g0432891
Entry ID 14537
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL18HanXRQChr14g0432891
Name HaENODL18HanXRQChr14g0432891
Class Early nodulin    [Orthogroup: ENODL011]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL18
start..stop
S start..stop
ThasENODL02 223 6e-74 6..224 12..234
AtENODL01 210 5e-69 1..196 9..201
HaENODL23 120 2e-34 22..149 20..147
HaCRX07 60 0.00000000002 1..151 4..138
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50986576..50986759 184 N° 2 50987933..50988435 503  
join(50986576..50986759,50987933..50988435)


exon

Literature and cross-references HaENODL18HanXRQChr14g0432891
DNA ref. HanXRQ genome:   HanXRQChr14 (50986576..50988435)
Protein sequence: HaENODL18HanXRQChr14g0432891
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   228 (205)
PWM (Da):   %s   24568.85 (22272.5)  
PI (pH):   %s   4.24 (4.06) Peptide Signal:   %s   cut: 24 range:24-228
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTVVVMVVVVLAAAANTKKVSGYKNYTVGDDLGWFDKLEKSTVDYQKWASSKTFSLGDFLIFNTDNNHTVVQTYNSTIYHLCDDSDAVGNDTILYASPDPSASAVHPVSVAVPLTRVGPNYFFSNDYDGEQCENGQRFSINVTQGQGLPPSLRTPTPGAPGPVSQESGDDTVPDTNVPANFDHPKDISDDDDDDDDNGKKKSNGMITQAWGGFSRILILLGLLYSCW

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGGTGGTGGTGATGGTTGTGGTTGTGCTAGCAGCAGCTGCAAACACAAAGAAAGTTTCAGGTTACAAGAACTACACCGTAGGAGACGATCTGGGCTGGTTTGACAAACTCGAA
AAGTCAACCGTCGATTATCAAAAATGGGCTTCTTCCAAAACCTTCTCTCTCGGTGATTTCCTCA
GTATGTTTCATCTTCCTTCATTTTTAGATATTACTTTGTGTGAACGCTAAGGGTAT
AAATGGAAAACAGTACCAATCCTTTTTTTTAACGGCAAAACACTATATATTATATCTATCTATATATAAACAGCCTATAAGCGGAATGAAGGTATCACTTTATATCAAAAATGTGCTTCT
TCCAAGACTTTCTTTTCTTGTTTGTGATACCTTCATTCGGTAGGTAATCAGATCTTTGCCGACAGACAGATTAGTGACTGTTTCTGGATTTGATCATTGATAAGCCGCAATTATTCACCA
GGAGAATTTTGTGATGATTATTTTTTTTTTATTGCTCTAAATCAAGAAACCATTTTAATTGGTTAAAAATTAAATATGTTTTAAAACAGATCGTGACAAAATAATCAGGTTTTATTTGCG
TGTAATAGTCGGTGGTTAATACACTTATACACATATCGTGTTTATTTTAATCATTTTATTAGTTACTGTTTTTTTTTTATTAATAAAGAGGACCCAGCAAGAGCTAGAAACCAAATTAAA
ATTACACTAACTAGGGCAGGTTATAAATTTAATTTATCATGTTGGCATACAACCTATATTAGTTTTTAATATATATAAATATCAACCAACTCATTTATTCCGAAACTTGATTAATAACCT
GGTTTTAACTTGACACCTGAGTCATAAGGCCGGTTAAGGTTAATACCTTAAAGGCTTATTCACAAAAATATATTCAAGGTGTCTATATGAACACTTGAGATAAATTTGGATCACTTCCCG
ATCATATCCCTCTCCACTAGACATAATTCAGAAGGAAACCCAATAAATGGGAAAACCCCATTTGTGGGCATCGAACCCAAGACCTATTGATCCCAAAGCCTTATCTCACCCTAACATGCA
GTAGCCTATAATTCCTACATCCAAATTTTATTAATTTCTATAATTCGTCGTTTAACCAGTCAAAAATCCAAGTGTCACCATGTTAAAAAAAGTTTTGGAGATAGCATGTCATGTGTGGTT
AGTTATTGCCAGCTATAAAGTATAAACTGCATGCATGGTAGCTTGTACGACAAGCAGTAGTGATTGTACATCCCTTTATTATTGGCGTTTGCTTGCAGATTTGTTTACATGTCCTTTTCA
AACATTTGTTTTTAATCTTTCCGGATTATCTATGCAGTTTTCAACACCGACAACAATCACACAGTTGTGCAAACATACAATTCCACCATCTACCACCTCTGCGATGACAGTGATGCTGTT
GGTAACGACACCATCCTATACGCATCACCCGACCCATCCGCCTCTGCAGTCCACCCGGTCTCTGTAGCCGTCCCGCTCACCAGGGTCGGTCCCAACTATTTCTTCTCCAATGATTACGAT
GGTGAGCAATGCGAAAACGGGCAACGCTTCAGTATCAATGTGACCCAAGGGCAGGGGTTGCCACCAAGTTTAAGGACTCCAACGCCTGGAGCCCCTGGTCCGGTCAGTCAAGAGTCTGGT
GACGATACAGTGCCCGACACAAACGTCCCGGCTAACTTTGATCACCCTAAAGATATCAGTGATGATGATGACGATGATGATGATAACGGCAAGAAGAAATCAAATGGCATGATTACACAA
GCGTGGGGCGGATTTAGCAGGATTTTGATTCTGTTGGGATTGCTATACAGCTGCTGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGGTGGTGGTGATGGTTGTGGTTGTGCTAGCAGCAGCTGCAAACACAAAGAAAGTTTCAGGTTACAAGAACTACACCGTAGGAGACGATCTGGGCTGGTTTGACAAACTCGAA
AAGTCAACCGTCGATTATCAAAAATGGGCTTCTTCCAAAACCTTCTCTCTCGGTGATTTCCTCA
TTTTCAACACCGACAACAATCACACAGTTGTGCAAACATACAATTCCACCATCTAC
CACCTCTGCGATGACAGTGATGCTGTTGGTAACGACACCATCCTATACGCATCACCCGACCCATCCGCCTCTGCAGTCCACCCGGTCTCTGTAGCCGTCCCGCTCACCAGGGTCGGTCCC
AACTATTTCTTCTCCAATGATTACGATGGTGAGCAATGCGAAAACGGGCAACGCTTCAGTATCAATGTGACCCAAGGGCAGGGGTTGCCACCAAGTTTAAGGACTCCAACGCCTGGAGCC
CCTGGTCCGGTCAGTCAAGAGTCTGGTGACGATACAGTGCCCGACACAAACGTCCCGGCTAACTTTGATCACCCTAAAGATATCAGTGATGATGATGACGATGATGATGATAACGGCAAG
AAGAAATCAAATGGCATGATTACACAAGCGTGGGGCGGATTTAGCAGGATTTTGATTCTGTTGGGATTGCTATACAGCTGCTGGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTATATATA TAGGGACATA CATATAGTAA AATTAATGAA CATCGAACAG GTGGTAGTTT ACAGAACAAG AAAGCGACCC TATCTTGTTG TACACTCAGA TCAAATCAGA GAGAGAGAGA  GATGAAGACG GTGGTGGTGA TGGTTGTGGT TGTGCTAGCA GCAGCTGCAA ACACAAAGAA AGTTTCAGGT TACAAGAACT ACACCGTAGG AGACGATCTG GGCTGGTTTG ACAAACTCGA  AAAGTCAACC GTCGATTATC AAAAATGGGC TTCTTCCAAA ACCTTCTCTC TCGGTGATTT CCTCATTTTC AACACCGACA ACAATCACAC AGTTGTGCAA ACATACAATT CCACCATCTA  CCACCTCTGC GATGACAGTG ATGCTGTTGG TAACGACACC ATCCTATACG CATCACCCGA CCCATCCGCC TCTGCAGTCC ACCCGGTCTC TGTAGCCGTC CCGCTCACCA GGGTCGGTCC  CAACTATTTC TTCTCCAATG ATTACGATGG TGAGCAATGC GAAAACGGGC AACGCTTCAG TATCAATGTG ACCCAAGGGC AGGGGTTGCC ACCAAGTTTA AGGACTCCAA CGCCTGGAGC  CCCTGGTCCG GTCAGTCAAG AGTCTGGTGA CGATACAGTG CCCGACACAA ACGTCCCGGC TAACTTTGAT CACCCTAAAG ATATCAGTGA TGATGATGAC GATGATGATG ATAACGGCAA  GAAGAAATCA AATGGCATGA TTACACAAGC GTGGGGCGGA TTTAGCAGGA TTTTGATTCT GTTGGGATTG CTATACAGCT GCTGGTAGAT CTAATTTTTT TTTTTATACT TGTATGTTAT 
TGTTTGTAAG 

Retrieve as FASTA