Entry information : HaENODL19HanXRQChr15g0487941
Entry ID 14538
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL19HanXRQChr15g0487941
Name HaENODL19HanXRQChr15g0487941
Class Early nodulin    [Orthogroup: ENODL007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL19
start..stop
S start..stop
HarENODL19 333 1e-119 1..162 1..162
HaENODL04 262 1e-91 1..162 1..166
HaENODL20 261 3e-91 1..162 1..164
AtENODL10 125 1e-37 5..161 3..157
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 103865913..103866090 178 N° 2 103864477..103864787 311  
complement(join(103864477..103864787,103865913..103866090))


exon

Literature and cross-references HaENODL19HanXRQChr15g0487941
DNA ref. HanXRQ genome:   HanXRQChr15 (103866090..103864477)
Protein sequence: HaENODL19HanXRQChr15g0487941
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162 (138)
PWM (Da):   %s   18267.19 (15617.8)  
PI (pH):   %s   8.01 (5.80) Peptide Signal:   %s   cut: 25 range:25-162
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRSGGDLWLKIVVMAAMLTFAVCRDPVRHLVGGNDRWKPNVNYTDWSLQQVFYVGDWLYFVYDRNLFNVLEVNETSYGNCSDQGFIFNITRGAGRDVFELTQPKQYYFLSSGGYCYNGMKVSVNVVEFVPAPVPSPPQSGSYMIKGINPLVLLIVIVVWAV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGATCCGGAGGAGATTTATGGCTGAAGATTGTTGTTATGGCGGCGATGCTAACATTCGCTGTGTGTAGAGATCCGGTGCGTCACCTCGTCGGTGGTAACGATAGGTGGAAACCT
AATGTTAATTACACTGATTGGTCACTTCAACAGGTTTTCTACGTCGGCGACTGGCTTT
GTAATTAACCATCTCTCTCTCTCTCTATATATATATATATATATTATATTGTTGTACGTTTT
TTTGTCATGATAATTATCGCATGCTAACGGAATCGTAATAGATCTCGTAAATTTGAAGCAGTTTTTTGAAGTTTTATCGCAAGCTTTTGAGTGTTCTTCGGCTACTTTATTCATTTATTT
AGTTTCTATTTAGTAAAATTAATTTTGCATTTGTTTAGATCATTTGTTGATAACTACGATAGACTGATTTATCTCTTCTTCTAATTAAATCATACATTGATTACAGATTTCGTTATAGCA
TTTTTTAATGATCCACTGCTACTCCAATCAAATTTGTGGTTAATTATTTCCTGTCAATTTTGATTTGTTAAGATTTTTTGGTGATAACTAAGATAAACTTATTCATCTCTTCTAATTTGA
TCCATTTTTCGTTCAGATCTCGTGTTTAAAACAAATCTATTGCAGATTTCCTTGTCGATAAGCATCTCTTTTAAATTTCATTGCATTTTTGAACGTTTCGCAGCGGCTACTCCAATTCAA
TTTTATCGCATTTTTGAAAAAGAACCATTCAAAGGACAACAGGTGTAAAAGCGGGTGTTAAGCCTTAGCTAGCCTTACACGTTTATCGGTTTATTTGGCTATTTTTGTGAGCTAAGCCTT
AGACGTCAGCTAAAATATGGCTGATTGGGATCGGTGGTGTTCTTTCGATCTGTTGTAATTATATTTTCTTGTGGTTTTCGGATTGCTTTTTCCGTCTTGGAAATAGTTGGTCTTGGTTTG
GTGGTTTAATGAAAGTCAATTTTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGCTAAAATATGGCTGGTGGTGTTGCCTAAATGTCTATTTTTAAAATGTTTAAAATAAATA
TCTATTTTTGTTAAAAAAGTAAGTCTACCAAATTTTCATGATTTTCCCTTTGTGGTTTATATAATTATATATAGTAAATTATTTTCTGTCAACTTTAAATTTGTTCAGAAATTTGATGAT
AGATATGATAAACTAAAATAATAATAATTCATATCTTCTTTTAAATCATTGCAATTAAAATTATTCAGATCTCGTGTTTAAATTAAAATCAAACCTATTGCAGATTTTGTGTACGATAGG
AACTTGTTCAACGTGTTAGAGGTAAACGAAACAAGCTATGGAAACTGCAGTGATCAAGGATTCATCTTCAACATCACGAGAGGCGCAGGACGTGATGTGTTTGAGCTCACTCAACCGAAA
CAATACTATTTCCTCTCAAGTGGTGGTTATTGCTACAATGGAATGAAAGTTAGCGTCAATGTGGTTGAATTTGTTCCTGCTCCTGTACCTTCCCCGCCCCAAAGTGGTTCCTACATGATT
AAAGGAATCAATCCGCTCGTCTTGTTGATAGTGATCGTTGTTTGGGCTGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACGATCCGGAGGAGATTTATGGCTGAAGATTGTTGTTATGGCGGCGATGCTAACATTCGCTGTGTGTAGAGATCCGGTGCGTCACCTCGTCGGTGGTAACGATAGGTGGAAACCT
AATGTTAATTACACTGATTGGTCACTTCAACAGGTTTTCTACGTCGGCGACTGGCTTT
ATTTTGTGTACGATAGGAACTTGTTCAACGTGTTAGAGGTAAACGAAACAAGCTATGGAAAC
TGCAGTGATCAAGGATTCATCTTCAACATCACGAGAGGCGCAGGACGTGATGTGTTTGAGCTCACTCAACCGAAACAATACTATTTCCTCTCAAGTGGTGGTTATTGCTACAATGGAATG
AAAGTTAGCGTCAATGTGGTTGAATTTGTTCCTGCTCCTGTACCTTCCCCGCCCCAAAGTGGTTCCTACATGATTAAAGGAATCAATCCGCTCGTCTTGTTGATAGTGATCGTTGTTTGG
GCTGTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTACTTTACG TTACCGAAAC TGCAATAAAG AAGATTGCCA GCCTGGCATT ATTTCCGACG GTATTGCGTG CTATTAATAC ACAACATCTT GTCTGCGTGT TTTCTACTGT GTGTAGGACA  TATCAGGAGT TGAAGATTTA GTGCACAATG AGACGATCCG GAGGAGATTT ATGGCTGAAG ATTGTTGTTA TGGCGGCGAT GCTAACATTC GCTGTGTGTA GAGATCCGGT GCGTCACCTC  GTCGGTGGTA ACGATAGGTG GAAACCTAAT GTTAATTACA CTGATTGGTC ACTTCAACAG GTTTTCTACG TCGGCGACTG GCTTTATTTT GTGTACGATA GGAACTTGTT CAACGTGTTA  GAGGTAAACG AAACAAGCTA TGGAAACTGC AGTGATCAAG GATTCATCTT CAACATCACG AGAGGCGCAG GACGTGATGT GTTTGAGCTC ACTCAACCGA AACAATACTA TTTCCTCTCA  AGTGGTGGTT ATTGCTACAA TGGAATGAAA GTTAGCGTCA ATGTGGTTGA ATTTGTTCCT GCTCCTGTAC CTTCCCCGCC CCAAAGTGGT TCCTACATGA TTAAAGGAAT CAATCCGCTC  GTCTTGTTGA TAGTGATCGT TGTTTGGGCT GTTTAGGTTC ATAAAGGATG AAGATTCAAA CAGGTTTTAC TAAATATTGT ACTCAATGTT TAATCACTGA TGTATGGATT CATGTTTAGT 
TATCTTGTTT TCATGTTTGA GTACATTTAT TTAATATCTT ACTGTTGTTT AAGTTATATT TTTATTGAAA TAATATAATT TGAATTTATG GTA 

Retrieve as FASTA