Entry information : HaENODL21HanXRQChr15g0488411
Entry ID 14540
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL21HanXRQChr15g0488411
Name HaENODL21HanXRQChr15g0488411
Class Early nodulin    [Orthogroup: ENODL007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL21
start..stop
S start..stop
HaENODL06 271 6e-95 2..172 6..175
HaENODL05 242 6e-83 2..164 17..203
AtENODL21 167 6e-54 8..168 9..168
ThasENODL01 162 6e-52 26..169 24..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106410037..106410217 181 N° 2 106408370..106408707 338  
complement(join(106408370..106408707,106410037..106410217))


exon

Literature and cross-references HaENODL21HanXRQChr15g0488411
DNA ref. HanXRQ genome:   HanXRQChr15 (106410217..106408370)
Protein sequence: HaENODL21HanXRQChr15g0488411
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172 (144)
PWM (Da):   %s   19060.66 (16289.2) Transmb domain:   %s   i9-28o
PI (pH):   %s   8.6 (8.65) Peptide Signal:   %s   cut: 29 range:29-172
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSKCTTAVALALCATLAVMLPELVAGKRYIVGGNMGWTTNYNYTLWAANQTFYRGDWLFFVYDRNQNDIIEVNKTNYETCNAEHPVHNYTTGAGRDVVELNVTHDRYFISSKGSCYGGMKLHVHLSRIPPPPRAAPIKSDSSTFTVLRSQLVIPAVVTIAAIWDSLLLRV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGGAGCAAATGTACGACGGCGGTGGCTCTGGCATTGTGCGCCACATTAGCGGTGATGTTGCCGGAATTAGTCGCCGGTAAACGGTACATCGTGGGAGGAAACATGGGCTGGACC
ACCAACTATAACTACACTCTTTGGGCCGCAAACCAAACATTCTACCGTGGTGACTGGCTCT
GTAAGTGTTTCTCTCAGATCTACTATTATTGTTCTGTAATTGCTGCTTTTGTGTATGTA
GAGGTTTGTTTCTGTTAATTTGAAGCTAGATCTTCGGTCATAGATGTTTGATTTTTTCATGTTCCTGTTAAATATGATTTATAATTTGCTAATTTGAGTGGAATGCTGAATATTATTAAG
TTTGTGGTTTATGAATTACTCGAGATCTGCAATTGGAAATTGTAGATCTTAGTTACTTGCTATAACAACAATCGTACCCGCAGATATAGCAAAGCTATTGTTAGGGTTTGAAAGAATATG
AATAAATATTACAATGTACATAAGCTTTGTTTAAGAAATTACTTGTCAAGCGATGTCATTTAGAGCGTCAGTAATGGGGTCTGTCGACCATTCGGGGACATCGCCACGGATGGTCCTGGG
AAGATTTTTGTAGGTTCTATGACAGGGGGTGGGGCGGTCCAGGGGCAGTTTCTGGGCAGGCTGATGTGGAGGGGTCTGTAACCCTTTTGCATTGCATTGCAGATGCTTTTAAAACCAACT
GAACTGTCCAAATCGAAGTAATTAGCCGGTTAAGTGCTTTGGTTGTTAACAGTTGGGCCGGCGGTTTTCAACTTGAAAGTGGCCGTGGAAACTAAACGGGCTTTTAACTTCTGTTGTTTT
CTATTCTATATTCGGAATATGCATTTAGACTATGAGGTGTGTGTGTGTGTGGGGGGGGGGGGGTTGGGTTGGGGGCATTGCTCGACACGTGGCGAGTGTGGGCTCCACCAGACCACCCCA
AAAAAAGTGGGGTGTGGAAGCGGCGTGGCCAGGCGGCGTTGGGGTGGCATGTTGATTTTTTAAAGAAGTGGGGTGTGGAAACGGTATCTCTCACCAGCCAATCCAAGCCAGCCACCTCAG
ACCTCCCCCCGCCCAACGCCAGGCTTCAAAACCACGCCAGCGGGGCAACGCTGGCCCGGTGTGGTTTAGCCAGCATTGCCTGGCATCCCCCGCCCCAACCAACGCCCCACACCCACTCGT
CTTATGTATATGGATAATATTTATGAATCATCTTTATCTTTCTAATAGATTAACATTTTGAACAAAGAAAAAAAGAAGGTTCAAACTCCTAGACCTCCAAAATCAAGTTGTTTTTTTGGT
TTTCTATAACTGTAGTTAGCGGTTCTGTCAAAAGTTTTTTTTAGAACCAACTAGACCAGACGCTGAACACCCAACGTGTGATATAAGAACAAATATAAATATCAGCACCATATTAGTCAA
TTACAATCATTGTACTACATCTCAAACTAGAAACCTTTTTGGGTCTTAATAAAAGTTTCCCTCTTTGCAGTTTTCGTGTATGACCGAAACCAAAACGACATAATAGAAGTGAACAAGACC
AACTACGAAACCTGCAATGCTGAGCATCCAGTTCACAACTACACAACAGGAGCCGGAAGAGATGTGGTGGAGCTCAACGTCACCCATGACCGCTACTTCATTAGTAGCAAAGGGTCCTGC
TACGGCGGCATGAAACTGCACGTACATCTCTCTCGTATACCACCACCCCCACGTGCAGCCCCTATCAAGAGTGACTCTTCAACATTCACCGTTCTCAGAAGCCAGCTCGTGATCCCTGCT
GTAGTCACCATCGCCGCAATATGGGACTCACTACTGCTCCGTGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGGAGCAAATGTACGACGGCGGTGGCTCTGGCATTGTGCGCCACATTAGCGGTGATGTTGCCGGAATTAGTCGCCGGTAAACGGTACATCGTGGGAGGAAACATGGGCTGGACC
ACCAACTATAACTACACTCTTTGGGCCGCAAACCAAACATTCTACCGTGGTGACTGGCTCT
TTTTCGTGTATGACCGAAACCAAAACGACATAATAGAAGTGAACAAGACCAACTACGAA
ACCTGCAATGCTGAGCATCCAGTTCACAACTACACAACAGGAGCCGGAAGAGATGTGGTGGAGCTCAACGTCACCCATGACCGCTACTTCATTAGTAGCAAAGGGTCCTGCTACGGCGGC
ATGAAACTGCACGTACATCTCTCTCGTATACCACCACCCCCACGTGCAGCCCCTATCAAGAGTGACTCTTCAACATTCACCGTTCTCAGAAGCCAGCTCGTGATCCCTGCTGTAGTCACC
ATCGCCGCAATATGGGACTCACTACTGCTCCGTGTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGTGACCTC CCTTTCGTGT TATAAAATCA ACTACATATC CTCAGTCCTC CTCACTCACT CCATATTTCT CTCTAAAAAT AAAAATAAAA GTTAGTTCAC ACCTTCAATG GGGCGGAGCA  AATGTACGAC GGCGGTGGCT CTGGCATTGT GCGCCACATT AGCGGTGATG TTGCCGGAAT TAGTCGCCGG TAAACGGTAC ATCGTGGGAG GAAACATGGG CTGGACCACC AACTATAACT  ACACTCTTTG GGCCGCAAAC CAAACATTCT ACCGTGGTGA CTGGCTCTTT TTCGTGTATG ACCGAAACCA AAACGACATA ATAGAAGTGA ACAAGACCAA CTACGAAACC TGCAATGCTG  AGCATCCAGT TCACAACTAC ACAACAGGAG CCGGAAGAGA TGTGGTGGAG CTCAACGTCA CCCATGACCG CTACTTCATT AGTAGCAAAG GGTCCTGCTA CGGCGGCATG AAACTGCACG  TACATCTCTC TCGTATACCA CCACCCCCAC GTGCAGCCCC TATCAAGAGT GACTCTTCAA CATTCACCGT TCTCAGAAGC CAGCTCGTGA TCCCTGCTGT AGTCACCATC GCCGCAATAT  GGGACTCACT ACTGCTCCGT GTCTGATGCA GTAATGTATT TGATGACAGA TGGCAGACGA AATCGTTGTC ATCTAGAATC GATAGGTAGG TTCTACCGCC CAAAATGGGT ACACCTTGTG  TTTGGGTAAT ACTGTTTTAA TCTTTTTCAG TGGGTGTTGT ATTTGTTTGT GGTTCATTAT CTTTAATTTG GCCTACATTT CAAACTTGAT TTGTGGGTTT GATTGTGTTG GGTGGATGAA  TGTAACTGAA CATTGATTTA CTTGGATCAT TAATTTATTT ATTTCACTGC GTGACTATTG ACTAACGGTT CTGTTCTGTT CTGTGGCCGT GTGGTCTCTT AGCGTTTTAG CCAGTTCGAC 
AAAAGATAAG TG 

Retrieve as FASTA