Entry information : HaENODL22HanXRQChr15g0494601
Entry ID 14541
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL22HanXRQChr15g0494601
Name HaENODL22HanXRQChr15g0494601
Class Early nodulin    [Orthogroup: ENODL001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL22
start..stop
S start..stop
HaENODL10 192 3e-60 23..147 5..128
HaENODL10 46 0.000002 153..213 345..411
HaENODL14 184 3e-58 18..153 2..136
HaENODL15 165 3e-51 6..144 3..140
AtENODL18 139 9e-42 23..207 9..191
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 151685927..151686146 220 N° 2 151686706..151687127 422  
join(151685927..151686146,151686706..151687127)


exon

Literature and cross-references HaENODL22HanXRQChr15g0494601
DNA ref. HanXRQ genome:   HanXRQChr15 (151685927..151687127)
Protein sequence: HaENODL22HanXRQChr15g0494601
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   213
PWM (Da):   %s   22539.14 Transmb domain:   %s   o15-37i193-212o
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTAILLLPSSFNNSMASFHTYLYVFFTLFSTLLCVSKAFNLTVGGKDGWTLHPSEAYDHWSGRLRFNVNDNLHFKYNGGSDSVMEVNRGDYGSCNTNNPITTLTGSGDSFFNLNRSGPFYFISGNKSNCDQGQKLTVVVLSPRKNQTPPTIALAPGSFSPVPAGGIASSSPTGNPMDVNAPAPEGSLATKPAISATLIGSLAMIVFGLGWVY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACTGCAATCTTGCTTTTACCCTCTTCTTTCAATAATTCAATGGCTTCCTTTCACACATATCTCTACGTTTTCTTCACATTATTCTCCACTTTACTCTGTGTTTCCAAGGCTTTC
AATTTGACCGTTGGCGGCAAAGACGGCTGGACTTTACACCCTTCTGAAGCATACGATCATTGGTCAGGCAGATTGAGGTTTAATGTCAACGACAATCTCC
GTAAGTATTTATGTCCTTGT
TTTTTTGGTTTTTGGAATATTTGATTTGGTATTACAGAGGTAATTGAGCTCAAGCACTTGAGATCTATTCGTTATAAGTTATATTAATAAATTCAAAAAACAGAGACTATTATAGACTAA
TGGCAGGTAGAAAGCAACAAGTTGCGCCGTTATCCTCTTCTAAATAGCAAACCCTACCCTGCTAAGTTTGAATTCAGTCGAGCTCGAGCTTGAGCCAGAACTCGAGCCTTAAAATAAATT
AGTTTTACAAACGAGTCTAGGCTCGAGTTTCATTTATCGAGCTCAAGTAGTTCACCGAGCCTAACAAACAAATTATTTATTCAAATTTTGTTTTGTTTTAAATATATATTACGAAATAAT
TATTTTATTATTATGTATAAAATTCGATAAACCAAATATTATATTATATTTTGTTATAAGGAAGCAACCGAACTCACGAAAATGAAACAAGGTGAGCTCCGTCTGGATTCAGTTCGTTGC
ATTCCTTTCATTTTGATTTTGTGAAGTGGGTGTTAACAATTATGAATCTTGACTTGCAGATTTCAAGTATAATGGTGGGTCGGATTCTGTAATGGAGGTCAACAGAGGCGATTACGGTAG
TTGCAACACGAATAACCCCATCACCACCCTTACCGGCAGTGGCGATTCTTTCTTCAATTTGAATCGTTCAGGACCTTTTTACTTCATCAGTGGCAATAAATCGAACTGTGATCAGGGTCA
GAAGCTAACTGTCGTCGTTTTGTCCCCAAGGAAAAATCAAACACCACCTACTATTGCACTAGCTCCGGGCAGCTTTTCACCGGTTCCAGCGGGTGGAATCGCGTCATCTTCTCCGACCGG
TAACCCCATGGACGTGAATGCACCGGCACCGGAAGGGTCACTGGCGACAAAACCAGCAATTTCTGCCACCTTGATTGGGTCACTTGCCATGATAGTATTCGGGCTGGGCTGGGTTTATTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACTGCAATCTTGCTTTTACCCTCTTCTTTCAATAATTCAATGGCTTCCTTTCACACATATCTCTACGTTTTCTTCACATTATTCTCCACTTTACTCTGTGTTTCCAAGGCTTTC
AATTTGACCGTTGGCGGCAAAGACGGCTGGACTTTACACCCTTCTGAAGCATACGATCATTGGTCAGGCAGATTGAGGTTTAATGTCAACGACAATCTCC
ATTTCAAGTATAATGGTGGG
TCGGATTCTGTAATGGAGGTCAACAGAGGCGATTACGGTAGTTGCAACACGAATAACCCCATCACCACCCTTACCGGCAGTGGCGATTCTTTCTTCAATTTGAATCGTTCAGGACCTTTT
TACTTCATCAGTGGCAATAAATCGAACTGTGATCAGGGTCAGAAGCTAACTGTCGTCGTTTTGTCCCCAAGGAAAAATCAAACACCACCTACTATTGCACTAGCTCCGGGCAGCTTTTCA
CCGGTTCCAGCGGGTGGAATCGCGTCATCTTCTCCGACCGGTAACCCCATGGACGTGAATGCACCGGCACCGGAAGGGTCACTGGCGACAAAACCAGCAATTTCTGCCACCTTGATTGGG
TCACTTGCCATGATAGTATTCGGGCTGGGCTGGGTTTATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACTG CAATCTTGCT TTTACCCTCT TCTTTCAATA ATTCAATGGC TTCCTTTCAC ACATATCTCT ACGTTTTCTT CACATTATTC TCCACTTTAC TCTGTGTTTC CAAGGCTTTC  AATTTGACCG TTGGCGGCAA AGACGGCTGG ACTTTACACC CTTCTGAAGC ATACGATCAT TGGTCAGGCA GATTGAGGTT TAATGTCAAC GACAATCTCC ATTTCAAGTA TAATGGTGGG  TCGGATTCTG TAATGGAGGT CAACAGAGGC GATTACGGTA GTTGCAACAC GAATAACCCC ATCACCACCC TTACCGGCAG TGGCGATTCT TTCTTCAATT TGAATCGTTC AGGACCTTTT  TACTTCATCA GTGGCAATAA ATCGAACTGT GATCAGGGTC AGAAGCTAAC TGTCGTCGTT TTGTCCCCAA GGAAAAATCA AACACCACCT ACTATTGCAC TAGCTCCGGG CAGCTTTTCA  CCGGTTCCAG CGGGTGGAAT CGCGTCATCT TCTCCGACCG GTAACCCCAT GGACGTGAAT GCACCGGCAC CGGAAGGGTC ACTGGCGACA AAACCAGCAA TTTCTGCCAC CTTGATTGGG 
TCACTTGCCA TGATAGTATT CGGGCTGGGC TGGGTTTATT AGTTTGTTAT CTCTTGTGTG AACATTTGAA TTAGGTTTC 

Retrieve as FASTA