Entry information : HaENODL23HanXRQChr16g0523401
Entry ID 14542
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaENODL23HanXRQChr16g0523401
Name HaENODL23HanXRQChr16g0523401
Class Early nodulin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaENODL23
start..stop
S start..stop
HaENODL18 131 2e-38 19..156 21..158
AtENODL01 129 1e-37 9..172 14..179
ThasENODL02 119 1e-33 7..172 15..184
AtUCC01 61 0.00000000002 7..156 8..145
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 149689781..149689964 184 N° 2 149690339..149690781 443  
join(149689781..149689964,149690339..149690781)


exon

Literature and cross-references HaENODL23HanXRQChr16g0523401
DNA ref. HanXRQ genome:   HanXRQChr16 (149689781..149690781)
Protein sequence: HaENODL23HanXRQChr16g0523401
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (187)
PWM (Da):   %s   21973.45 (19895.3)  
PI (pH):   %s   3.93 (3.82) Peptide Signal:   %s   cut: 22 range:22-208
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPATAIHLTLLALFLTGATAYTNHTVGDKAGWLFDPNTNTSSANYASWSANQTFELGDYLIFNTNTNQTVILTYNETTYRSCSTDNSSDSDTFSYSSGNQQFGQPLTVAVPLTIEGANYFFSDASDGVQCQNGMAFGINVTHGVGLPPSLNQPPPPPYVEPPANGDGSLTPPVSDQPSGAGLSDGVNVRRVVCYVLTFCGIFCLFLV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGGCGACGGCGATACATTTAACACTACTTGCACTTTTCCTCACCGGCGCCACCGCATACACCAACCACACCGTCGGAGACAAAGCCGGCTGGCTTTTCGATCCAAACACCAAC
ACATCCTCCGCTAATTACGCCTCCTGGAGCGCTAATCAAACCTTCGAACTCGGCGACTACTTAA
GTAAGTACGACTTTCAATCGGTCAAAATCGATTCGATTTGTGTTCAATAGATTTCA
TTTGATGATCTGATTCGATTTCGATTAGGATTGCGATTTTGATTATTGTGAAGTTTTTTGGAGAAATACATTGATCTAAACTTGATTTAGGTTTTGATTTTGATATTGATTTGATGAATA
ATGTGTAGTATGCAACACGAACACGAATCAGACGGTTATTTTGACTTAAGCTTGAGTTTGAATTGGTCAAAATCGATTCGATCTGTTTGCAATATATTTCAATTCATGATCTGATCTGAT
TTGATTCCGATTCAGATCGTATAGATTTTGATTTTGATTTCGAATTTGAATTTGATTTTAATTTTGATTAACATGTAGTATTCAACACGAACACGAATCAGACGGTTATTTTAACCTACA
ACGAAACGACGTACCGTAGCTGCAGCACCGATAACTCATCAGATAGTGATACATTCAGTTACAGCTCAGGGAACCAGCAGTTCGGGCAGCCGTTGACCGTTGCGGTTCCGTTGACTATCG
AAGGAGCAAACTACTTCTTCTCCGATGCTAGTGACGGTGTTCAGTGCCAGAACGGGATGGCGTTCGGGATCAACGTCACTCATGGCGTCGGACTTCCGCCGAGTCTTAATCAACCTCCGC
CGCCGCCGTATGTTGAGCCTCCGGCGAACGGTGATGGAAGCCTTACGCCGCCGGTGAGTGATCAGCCAAGTGGCGCTGGATTAAGTGATGGTGTTAATGTGCGCCGGGTGGTATGTTACG
TGCTCACATTTTGTGGAATATTTTGTTTGTTTTTAGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGGCGACGGCGATACATTTAACACTACTTGCACTTTTCCTCACCGGCGCCACCGCATACACCAACCACACCGTCGGAGACAAAGCCGGCTGGCTTTTCGATCCAAACACCAAC
ACATCCTCCGCTAATTACGCCTCCTGGAGCGCTAATCAAACCTTCGAACTCGGCGACTACTTAA
TATTCAACACGAACACGAATCAGACGGTTATTTTAACCTACAACGAAACGACGTAC
CGTAGCTGCAGCACCGATAACTCATCAGATAGTGATACATTCAGTTACAGCTCAGGGAACCAGCAGTTCGGGCAGCCGTTGACCGTTGCGGTTCCGTTGACTATCGAAGGAGCAAACTAC
TTCTTCTCCGATGCTAGTGACGGTGTTCAGTGCCAGAACGGGATGGCGTTCGGGATCAACGTCACTCATGGCGTCGGACTTCCGCCGAGTCTTAATCAACCTCCGCCGCCGCCGTATGTT
GAGCCTCCGGCGAACGGTGATGGAAGCCTTACGCCGCCGGTGAGTGATCAGCCAAGTGGCGCTGGATTAAGTGATGGTGTTAATGTGCGCCGGGTGGTATGTTACGTGCTCACATTTTGT
GGAATATTTTGTTTGTTTTTAGTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTCAAACT CTTTCGAAAT TAGAAATCAG ATCGCTACTT CCAATCACCG ACCACAGGTA ACCTCCACTC TTCCAGCCGG ATCCAATGGC TCCGGCGACG GCGATACATT TAACACTACT  TGCACTTTTC CTCACCGGCG CCACCGCATA CACCAACCAC ACCGTCGGAG ACAAAGCCGG CTGGCTTTTC GATCCAAACA CCAACACATC CTCCGCTAAT TACGCCTCCT GGAGCGCTAA  TCAAACCTTC GAACTCGGCG ACTACTTAAT ATTCAACACG AACACGAATC AGACGGTTAT TTTAACCTAC AACGAAACGA CGTACCGTAG CTGCAGCACC GATAACTCAT CAGATAGTGA  TACATTCAGT TACAGCTCAG GGAACCAGCA GTTCGGGCAG CCGTTGACCG TTGCGGTTCC GTTGACTATC GAAGGAGCAA ACTACTTCTT CTCCGATGCT AGTGACGGTG TTCAGTGCCA  GAACGGGATG GCGTTCGGGA TCAACGTCAC TCATGGCGTC GGACTTCCGC CGAGTCTTAA TCAACCTCCG CCGCCGCCGT ATGTTGAGCC TCCGGCGAAC GGTGATGGAA GCCTTACGCC  GCCGGTGAGT GATCAGCCAA GTGGCGCTGG ATTAAGTGAT GGTGTTAATG TGCGCCGGGT GGTATGTTAC GTGCTCACAT TTTGTGGAAT ATTTTGTTTG TTTTTAGTGT GAAAGAGGTA  GTTGGTGTAT TTTCGTGGGG TCGAGTTCAG TGTTGAAAAA TGTTTTTTTT GAGGTGATAG AATTACAGAA AAACTCCATT GATGGGGTTA GGTTATAATT ATTTAAACTT TTGTGGTTAG 
ATTTATATTT ATAAATATCT TAATCTTTAT TTTACTTTAA AAAATGTGGT AAAATTTAAT TTATAATGAA TGATGGTTAT GGTTGTTCAC TAGCCGAGCT TAG 

Retrieve as FASTA