Entry information : HaCRX06HanXRQChr05g0162051
Entry ID 14548
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCRX06HanXRQChr05g0162051
Name HaCRX06HanXRQChr05g0162051
Class Other cupredoxin Protein    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCRX06
start..stop
S start..stop
ThasSTC01-1 73 2e-17 40..141 29..128
ThasSTC03 73 2e-17 36..140 27..130
HaCRX08 72 1e-16 36..136 30..130
PpaENODL17 70 2e-16 14..135 5..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 213732683..213732884 202 N° 2 213732958..213733181 224  
join(213732683..213732884,213732958..213733181)


exon

Literature and cross-references HaCRX06HanXRQChr05g0162051
DNA ref. HanXRQ genome:   HanXRQChr05 (213732683..213733181)
Protein sequence: HaCRX06HanXRQChr05g0162051
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   141
PWM (Da):   %s   16181.96 Transmb domain:   %s   o5-27i
PI (pH):   %s   4.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAADGGHWFSILATIIVPLATVIILFTPACSGTITHTVGDSIWSIPQTEGFYNKWASSRLFRPGDILYFEFDRDLYHVMRVQNWEYQMCETNIVIPWEVYRDGKAWVTLPEEGYYTYICNVLDYCSLGLRFELKVNKSDSP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGGACGGAGGTCACTGGTTTTCAATATTAGCGACAATTATAGTACCACTGGCGACAGTTATAATACTCTTTACCCCAGCCTGCAGTGGAACGATCACACACACAGTGGGTGAC
TCCATTTGGTCGATCCCACAAACCGAAGGCTTTTATAACAAGTGGGCGTCTTCTCGGCTTTTTCGTCCAGGAGACATTCTCT
GTATGTGTTAATTACTTATAATTCAATTCACTTAAACA
AACCGCTTTAAGTTGAATAGAATAATTACTTGCAGATTTCGAATTTGATCGAGATTTATACCACGTGATGCGGGTTCAGAATTGGGAGTACCAGATGTGCGAGACCAACATTGTAATTCC
GTGGGAGGTTTACCGTGACGGGAAGGCGTGGGTTACTTTACCAGAGGAGGGTTATTATACTTACATATGCAATGTGTTGGACTATTGTTCCTTAGGGTTAAGATTTGAGTTAAAGGTTAA
CAAGAGCGATTCCCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCGGACGGAGGTCACTGGTTTTCAATATTAGCGACAATTATAGTACCACTGGCGACAGTTATAATACTCTTTACCCCAGCCTGCAGTGGAACGATCACACACACAGTGGGTGAC
TCCATTTGGTCGATCCCACAAACCGAAGGCTTTTATAACAAGTGGGCGTCTTCTCGGCTTTTTCGTCCAGGAGACATTCTCT
ATTTCGAATTTGATCGAGATTTATACCACGTGATGCGG
GTTCAGAATTGGGAGTACCAGATGTGCGAGACCAACATTGTAATTCCGTGGGAGGTTTACCGTGACGGGAAGGCGTGGGTTACTTTACCAGAGGAGGGTTATTATACTTACATATGCAAT
GTGTTGGACTATTGTTCCTTAGGGTTAAGATTTGAGTTAAAGGTTAACAAGAGCGATTCCCCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCACTTCCT CTTCTCATAA CTGCACACAC ACACCCTTAC AATGGCAGCG GACGGAGGTC ACTGGTTTTC AATATTAGCG ACAATTATAG TACCACTGGC GACAGTTATA ATACTCTTTA  CCCCAGCCTG CAGTGGAACG ATCACACACA CAGTGGGTGA CTCCATTTGG TCGATCCCAC AAACCGAAGG CTTTTATAAC AAGTGGGCGT CTTCTCGGCT TTTTCGTCCA GGAGACATTC  TCTATTTCGA ATTTGATCGA GATTTATACC ACGTGATGCG GGTTCAGAAT TGGGAGTACC AGATGTGCGA GACCAACATT GTAATTCCGT GGGAGGTTTA CCGTGACGGG AAGGCGTGGG  TTACTTTACC AGAGGAGGGT TATTATACTT ACATATGCAA TGTGTTGGAC TATTGTTCCT TAGGGTTAAG ATTTGAGTTA AAGGTTAACA AGAGCGATTC CCCTTGAGGA GGCTAGTTGA 
CGTTTGTTTC ATTGTTTTTT AAGGTTTGTT TATGAACATG ATGGATGTTA TTCTACCAAT GTAATTGGGT GTTTGGATTT TCGTT 

Retrieve as FASTA