Entry information : HaCRX08HanXRQChr09g0241561
Entry ID 14550
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCRX08HanXRQChr09g0241561
Name HaCRX08HanXRQChr09g0241561
Class Other cupredoxin Protein    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCRX08
start..stop
S start..stop
HaCRX07 279 2e-97 1..191 1..193
HaCRX14 179 2e-57 1..129 1..132
HaCRX10 177 9e-57 9..130 9..130
HaCRX09 174 6e-56 8..191 7..186
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24696708..24696793 86 N° 2 24695935..24696424 490  
complement(join(24695935..24696424,24696708..24696793))


exon

Literature and cross-references HaCRX08HanXRQChr09g0241561
DNA ref. HanXRQ genome:   HanXRQChr09 (24696793..24695935)
Protein sequence: HaCRX08HanXRQChr09g0241561
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191 (165)
PWM (Da):   %s   19853.06 (17038.6)  
PI (pH):   %s   8.09 (6.92) Peptide Signal:   %s   cut: 27 range:27-191
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVLKSNMVVLVVMMVASFHLRSTVAQTRHVVGDALGWTIPSGGASTYATWASQQTFTVGDTLYFNFTTGMHNVAEVSQAAYRPCTTTNTLSLNPNGPATVTLTRPGTHYYICTVVSHCQIGQKLTINVSPLTATAPESTPLSPPSTIATPPSAFEPSPTGSVIPPPSSASPPLASVVPITFLAVALAFFY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTACTGAAGTCAAATATGGTTGTATTGGTGGTCATGATGGTTGCATCTTTCCACCTGCGGTCCACGGTGGCGCAAACAAGGTATGTTTTGTATTAGGGGCTAGCTAAACCTACG
CAACCCTGATCAAATTATCATCGTACCCCACCCCTTAAAATATCAAATTAAGCTAGAGTATCTCTTTTGTCTTTTACGGTGAAAAAAAAAATTAAGGAATAGTTGTCTTTTACGTGACAA
CTGTATGAAAAGTAAAAACGAAGAGGGTGGGGTACGTTCAATAAGACCCTTCTATTATTGTAATCTAGTACATAATGTAGGTGCTTATATACTACTAAACATAATTGACATGATCTACTA
TAATAACAGGCACGTCGTTGGGGACGCCTTGGGGTGGACGATTCCTTCTGGCGGCGCTTCCACTTACGCCACTTGGGCTTCTCAACAAACCTTCACCGTCGGCGATACACTTTATTTTAA
CTTTACCACTGGAATGCATAACGTGGCCGAAGTTTCTCAGGCGGCTTATCGCCCATGCACTACCACCAACACCCTCTCACTCAACCCTAACGGCCCCGCCACCGTTACATTGACCCGCCC
TGGGACCCACTACTATATTTGCACTGTTGTGAGTCATTGTCAAATTGGTCAGAAATTAACCATCAATGTCTCTCCCCTTACCGCCACTGCTCCTGAATCTACACCCCTATCTCCACCATC
TACCATCGCTACTCCTCCGTCTGCCTTTGAACCATCTCCCACCGGCAGCGTCATTCCACCACCATCAAGCGCATCTCCACCTTTGGCCTCCGTGGTTCCCATCACTTTCTTGGCAGTTGC
TTTGGCTTTCTTTTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTACTGAAGTCAAATATGGTTGTATTGGTGGTCATGATGGTTGCATCTTTCCACCTGCGGTCCACGGTGGCGCAAACAAGGCACGTCGTTGGGGACGCCTTGGGGTGGACGATT
CCTTCTGGCGGCGCTTCCACTTACGCCACTTGGGCTTCTCAACAAACCTTCACCGTCGGCGATACACTTTATTTTAACTTTACCACTGGAATGCATAACGTGGCCGAAGTTTCTCAGGCG
GCTTATCGCCCATGCACTACCACCAACACCCTCTCACTCAACCCTAACGGCCCCGCCACCGTTACATTGACCCGCCCTGGGACCCACTACTATATTTGCACTGTTGTGAGTCATTGTCAA
ATTGGTCAGAAATTAACCATCAATGTCTCTCCCCTTACCGCCACTGCTCCTGAATCTACACCCCTATCTCCACCATCTACCATCGCTACTCCTCCGTCTGCCTTTGAACCATCTCCCACC
GGCAGCGTCATTCCACCACCATCAAGCGCATCTCCACCTTTGGCCTCCGTGGTTCCCATCACTTTCTTGGCAGTTGCTTTGGCTTTCTTTTACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATCAAAGC ACCAACAATC TTGAGACAAT AATATAAGTG GCGACCTGAG TTTCAACACA ACAATATAAA AATGGCAGTA CTGAAGTCAA ATATGGTTGT ATTGGTGGTC ATGATGGTTG  CATCTTTCCA CCTGCGGTCC ACGGTGGCGC AAACAAGGCA CGTCGTTGGG GACGCCTTGG GGTGGACGAT TCCTTCTGGC GGCGCTTCCA CTTACGCCAC TTGGGCTTCT CAACAAACCT  TCACCGTCGG CGATACACTT TATTTTAACT TTACCACTGG AATGCATAAC GTGGCCGAAG TTTCTCAGGC GGCTTATCGC CCATGCACTA CCACCAACAC CCTCTCACTC AACCCTAACG  GCCCCGCCAC CGTTACATTG ACCCGCCCTG GGACCCACTA CTATATTTGC ACTGTTGTGA GTCATTGTCA AATTGGTCAG AAATTAACCA TCAATGTCTC TCCCCTTACC GCCACTGCTC  CTGAATCTAC ACCCCTATCT CCACCATCTA CCATCGCTAC TCCTCCGTCT GCCTTTGAAC CATCTCCCAC CGGCAGCGTC ATTCCACCAC CATCAAGCGC ATCTCCACCT TTGGCCTCCG  TGGTTCCCAT CACTTTCTTG GCAGTTGCTT TGGCTTTCTT TTACTAGATC AATTTGATTG AACGGAGACA GGGAGTTTTT ATTTTCTTGA TGTTTTTACC AATTTCTGAC CTTTTTGCTT 
ATTTGTTTTT ATCCATTGTA TTGTTTGTAC CCTCATATAT TCATGTAAGA AAGTTCACAT TATTGTATAT TTAATATTTT GAGGCCATGC CATGTGTTTC TTTTCATCAA AT 

Retrieve as FASTA