Entry information : HaCRX09HanXRQChr09g0241571
Entry ID 14551
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCRX09HanXRQChr09g0241571
Name HaCRX09HanXRQChr09g0241571
Class Other cupredoxin Protein    [Orthogroup: CRX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCRX09
start..stop
S start..stop
HaCRX08 180 2e-58 16..186 17..191
HaCRX07 177 4e-57 7..186 8..193
HaCRX14 172 1e-54 1..128 4..132
HaCRX10 145 2e-44 2..132 3..133
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24716226..24716308 83 N° 2 24715468..24715945 478  
complement(join(24715468..24715945,24716226..24716308))


exon

Literature and cross-references HaCRX09HanXRQChr09g0241571
DNA ref. HanXRQ genome:   HanXRQChr09 (24716308..24715468)
Protein sequence: HaCRX09HanXRQChr09g0241571
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186 (161)
PWM (Da):   %s   18949.34 (16411.0)  
PI (pH):   %s   8.35 (8.10) Peptide Signal:   %s   cut: 26 range:26-186
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSKLMMVVAVIAIASFCVQSTVAQTRHVVGDATGWAVPPNGNATYVTWASGKTFNVGDTLFFNFTTGAHDVTEVSQASYGPCTAANPISHITNGPATVTLRTTGNHYFICTVGPHCNLGQKLMINVRGSSTTPAPTGSMTPPPTGSMTPPPTGTTTSPPPPSSSSSLSVVVPVTFLAAALAFFY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCATCCAAGTTAATGATGGTTGTGGCCGTTATCGCCATCGCTTCGTTTTGCGTGCAATCCACCGTGGCACAAACAAGGTACCTTTTATATAATTCTGACTAGTTTTGTATTCTT
TTATCTTTTTAATACTATAGAAGGGATGACAACTCAGTTTGTTGCTCGTCTATTTACTATTCTTATGTAATTTGCCCTTTTGATTGAAATGAAATACTACAAATTATTGTTAAAAAAATA
AAAATAAATAAATAAATTTTACCAAAAGATTTGTATTCTTTTACTTTTTTTTAATAAAGTTTATCAGAGTACCGTCCCATGTACCGAAAAAGATATAGCTAACACGATTTAATAAAATAA
CAGGCACGTCGTTGGAGACGCCACCGGTTGGGCCGTTCCTCCAAACGGAAACGCCACATACGTCACTTGGGCGTCCGGAAAAACATTCAACGTCGGCGACACGCTCTTTTTCAATTTCAC
TACCGGAGCGCATGACGTGACCGAGGTTTCACAGGCGTCATACGGCCCTTGCACCGCCGCGAACCCGATCTCTCACATCACAAACGGCCCCGCCACCGTCACCTTGAGAACCACGGGCAA
CCACTATTTTATTTGCACCGTAGGACCTCATTGCAACCTTGGTCAGAAACTTATGATCAATGTTCGTGGATCATCCACCACTCCAGCTCCTACCGGCAGCATGACTCCACCACCCACCGG
CAGCATGACTCCACCACCAACCGGCACCACCACTTCGCCACCGCCACCAAGCAGCTCATCATCTTTATCCGTCGTGGTACCCGTCACTTTCTTGGCAGCTGCTCTAGCTTTCTTCTACTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCATCCAAGTTAATGATGGTTGTGGCCGTTATCGCCATCGCTTCGTTTTGCGTGCAATCCACCGTGGCACAAACAAGGCACGTCGTTGGAGACGCCACCGGTTGGGCCGTTCCT
CCAAACGGAAACGCCACATACGTCACTTGGGCGTCCGGAAAAACATTCAACGTCGGCGACACGCTCTTTTTCAATTTCACTACCGGAGCGCATGACGTGACCGAGGTTTCACAGGCGTCA
TACGGCCCTTGCACCGCCGCGAACCCGATCTCTCACATCACAAACGGCCCCGCCACCGTCACCTTGAGAACCACGGGCAACCACTATTTTATTTGCACCGTAGGACCTCATTGCAACCTT
GGTCAGAAACTTATGATCAATGTTCGTGGATCATCCACCACTCCAGCTCCTACCGGCAGCATGACTCCACCACCCACCGGCAGCATGACTCCACCACCAACCGGCACCACCACTTCGCCA
CCGCCACCAAGCAGCTCATCATCTTTATCCGTCGTGGTACCCGTCACTTTCTTGGCAGCTGCTCTAGCTTTCTTCTACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAACCCGC ACCAATTTCC ACAACAACTA CTACAATCTT GACTTTTTAC ATCATAATAA GTCAACGTAA CGTACTCATT CAACAAACGT TCAAACATAA TTCCTATATA TACCTACCCA  TAATTCACTT CATCTTCACC AATCTCAAAT ATCTTTTAGA GAGAGAAAAC TCATTCCAAA TTTAGAAAGT TTCTAGAGAG AGAAACAGGG CGACCTGAGA TTTTAACACA AACACCAATG  GCATCATCCA AGTTAATGAT GGTTGTGGCC GTTATCGCCA TCGCTTCGTT TTGCGTGCAA TCCACCGTGG CACAAACAAG GCACGTCGTT GGAGACGCCA CCGGTTGGGC CGTTCCTCCA  AACGGAAACG CCACATACGT CACTTGGGCG TCCGGAAAAA CATTCAACGT CGGCGACACG CTCTTTTTCA ATTTCACTAC CGGAGCGCAT GACGTGACCG AGGTTTCACA GGCGTCATAC  GGCCCTTGCA CCGCCGCGAA CCCGATCTCT CACATCACAA ACGGCCCCGC CACCGTCACC TTGAGAACCA CGGGCAACCA CTATTTTATT TGCACCGTAG GACCTCATTG CAACCTTGGT  CAGAAACTTA TGATCAATGT TCGTGGATCA TCCACCACTC CAGCTCCTAC CGGCAGCATG ACTCCACCAC CCACCGGCAG CATGACTCCA CCACCAACCG GCACCACCAC TTCGCCACCG  CCACCAAGCA GCTCATCATC TTTATCCGTC GTGGTACCCG TCACTTTCTT GGCAGCTGCT CTAGCTTTCT TCTACTAGAT GAGTTTTGGT TGGTTCTAGT TTTTTTGTGT TACATTTTTA  TTTTTTGTGA TAAATAAGAT GTTTGATTGG ATATTTTTGT ATTGATGTAA TAAAATGTTT GGTTTTCATT TAATATTTAT TGTTTTGAGT AGAAAATATT AAAAAATCGT GAGAGGTCAA 
AACAAATTAT T 

Retrieve as FASTA