Entry information : HaCRX14HanXRQChr12g0356711
Entry ID 14555
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCRX14HanXRQChr12g0356711
Name HaCRX14HanXRQChr12g0356711
Class Other cupredoxin Protein    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCRX14
start..stop
S start..stop
HaCRX08 192 4e-62 1..243 1..191
HaCRX09 182 1e-58 4..145 1..145
HaCRX07 181 4e-58 1..243 1..193
HaCRX10 170 2e-53 1..134 1..131
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6433052..6433250 199 N° 2 6432003..6432535 533  
complement(join(6432003..6432535,6433052..6433250))


exon

Literature and cross-references HaCRX14HanXRQChr12g0356711
DNA ref. HanXRQ genome:   HanXRQChr12 (6433250..6432003)
Protein sequence: HaCRX14HanXRQChr12g0356711
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   243 (215)
PWM (Da):   %s   24503.96 (21424.6)  
PI (pH):   %s   7.56 (6.92) Peptide Signal:   %s   cut: 29 range:29-243
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAMKSSTTMFMMMMLIVASMQMHSSLAQTRHVVGGDALGWNIPSNGAAAYTTWASQQTFNVGDTLFFNFTTGFHNVAEVSQAAYGPCTTANPISTITTGPATVTLTAAGPHYYICTVGTHCQIGQKLSINVSAATATPPTTPPPASPPTTPPTTTPTPPAPTPVSPPTTNPSPAPAPSTTTPPPTTPMAPSPVGATPPSPTTSGPSPNGETTPPPPSPSTAARSFTAVIPATFLAVALAFFY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAATGAAGTCGAGTACGACAATGTTCATGATGATGATGCTCATTGTTGCATCCATGCAGATGCATAGCTCCTTGGCTCAGACTAGACACGTCGTCGGCGGAGACGCCTTGGGA
TGGAACATTCCATCCAATGGTGCCGCCGCTTACACCACCTGGGCTTCCCAACAGACTTTTAACGTCGGCGACACTCTCT
GTAAGTAACTAAAACCACCTTCTGTCGCCACTCATGGGCGG
AGCTTTATTAGGGGCGGGCCCCATCTATTTTCCGCTCCTAGTGTTAATTTTTCCCAAAAAAAAATCTTAAACTTTTTTTCGTAGTGTAGTGTAAAATATTGATTTTTTTTATTCTGGCCT
TTATCAAATTGAATTTTAAATGTCTAACTCATACTGAGTTTTCGTTCAAGTTCCACCACTGGTGTAACTATCACAACACCCCAATTAAGCTCACACAAACAAAAACAAATATTATAAGAA
TATTTTCTTTGATTAAAACTCAATATTCTATCTTTTTTAATTTATAAAAAAAAGTAGGTATAAGGAGAAACTAAATCATGTCACATGCAAACAAACCTAACTTCTCTATATTTCAAATCC
GGTGATATATTTATTAATATAATTGACTTTAGTGGTAGTAATTTAGCTAGATCATTATTGATTTATGATATAACTAATCAATTAATTAATCAAATTCTTTTATTTATATTTGCAGTTTTT
AACTTCACCACCGGATTCCATAACGTGGCCGAAGTATCACAAGCAGCATACGGCCCATGCACCACGGCCAACCCCATCTCCACCATCACCACCGGCCCTGCGACCGTCACATTGACGGCC
GCAGGCCCACATTACTATATTTGCACCGTCGGAACTCATTGCCAAATTGGTCAAAAATTATCCATCAACGTCTCCGCCGCCACCGCCACGCCCCCTACCACCCCACCACCAGCATCACCA
CCCACCACCCCACCTACAACCACCCCAACACCACCTGCACCGACACCCGTTTCTCCACCAACCACCAACCCCTCACCCGCCCCCGCCCCTTCCACCACCACCCCACCACCTACCACCCCT
ATGGCACCGTCACCCGTCGGAGCCACCCCACCGTCACCTACCACTTCCGGCCCATCTCCAAACGGTGAAACCACCCCTCCTCCACCGTCACCTAGCACCGCCGCCCGGTCATTCACCGCG
GTGATTCCGGCCACTTTCTTGGCCGTTGCTTTAGCTTTCTTTTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAATGAAGTCGAGTACGACAATGTTCATGATGATGATGCTCATTGTTGCATCCATGCAGATGCATAGCTCCTTGGCTCAGACTAGACACGTCGTCGGCGGAGACGCCTTGGGA
TGGAACATTCCATCCAATGGTGCCGCCGCTTACACCACCTGGGCTTCCCAACAGACTTTTAACGTCGGCGACACTCTCT
TTTTTAACTTCACCACCGGATTCCATAACGTGGCCGAAGTA
TCACAAGCAGCATACGGCCCATGCACCACGGCCAACCCCATCTCCACCATCACCACCGGCCCTGCGACCGTCACATTGACGGCCGCAGGCCCACATTACTATATTTGCACCGTCGGAACT
CATTGCCAAATTGGTCAAAAATTATCCATCAACGTCTCCGCCGCCACCGCCACGCCCCCTACCACCCCACCACCAGCATCACCACCCACCACCCCACCTACAACCACCCCAACACCACCT
GCACCGACACCCGTTTCTCCACCAACCACCAACCCCTCACCCGCCCCCGCCCCTTCCACCACCACCCCACCACCTACCACCCCTATGGCACCGTCACCCGTCGGAGCCACCCCACCGTCA
CCTACCACTTCCGGCCCATCTCCAAACGGTGAAACCACCCCTCCTCCACCGTCACCTAGCACCGCCGCCCGGTCATTCACCGCGGTGATTCCGGCCACTTTCTTGGCCGTTGCTTTAGCT
TTCTTTTACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCACACAAG CCTACTTTAC ATATACATAT AGAGAGAGAA ATCAACTCTC ATTTTTTCTA GAGAGAGTTA AAGGGGTGAC CATTCACAAG AACACCATAA ATGGCTGCAA TGAAGTCGAG  TACGACAATG TTCATGATGA TGATGCTCAT TGTTGCATCC ATGCAGATGC ATAGCTCCTT GGCTCAGACT AGACACGTCG TCGGCGGAGA CGCCTTGGGA TGGAACATTC CATCCAATGG  TGCCGCCGCT TACACCACCT GGGCTTCCCA ACAGACTTTT AACGTCGGCG ACACTCTCTT TTTTAACTTC ACCACCGGAT TCCATAACGT GGCCGAAGTA TCACAAGCAG CATACGGCCC  ATGCACCACG GCCAACCCCA TCTCCACCAT CACCACCGGC CCTGCGACCG TCACATTGAC GGCCGCAGGC CCACATTACT ATATTTGCAC CGTCGGAACT CATTGCCAAA TTGGTCAAAA  ATTATCCATC AACGTCTCCG CCGCCACCGC CACGCCCCCT ACCACCCCAC CACCAGCATC ACCACCCACC ACCCCACCTA CAACCACCCC AACACCACCT GCACCGACAC CCGTTTCTCC  ACCAACCACC AACCCCTCAC CCGCCCCCGC CCCTTCCACC ACCACCCCAC CACCTACCAC CCCTATGGCA CCGTCACCCG TCGGAGCCAC CCCACCGTCA CCTACCACTT CCGGCCCATC  TCCAAACGGT GAAACCACCC CTCCTCCACC GTCACCTAGC ACCGCCGCCC GGTCATTCAC CGCGGTGATT CCGGCCACTT TCTTGGCCGT TGCTTTAGCT TTCTTTTACT AGATATTGAT  AGTTAAAAGT TAATATTCTT TCTATGGAGA GATTACAATT ACACGATGTG TGCATGTGTG ATTAGTTTAT ATATTTTTGT AATGATTTAT TAACATTATG TTCTTATTCA TCATTCGTAT 
CAATAAATTT CACTTTTTAT TGC 

Retrieve as FASTA