Entry information : HaPNC02HanXRQChr04g0122601
Entry ID 14560
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC02HanXRQChr04g0122601
Name HaPNC02HanXRQChr04g0122601
Class Plantacyanin    [Orthogroup: PNC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC02
start..stop
S start..stop
HaPNC03 172 1e-57 43..130 1..88
HaPNC06 152 3e-49 1..124 1..120
HaPNC17 124 4e-38 1..124 1..118
HaPNC16 116 4e-35 1..120 1..115
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 162407788..162407983 196 N° 2 162407076..162407272 197  
complement(join(162407076..162407272,162407788..162407983))


exon

Literature and cross-references HaPNC02HanXRQChr04g0122601
DNA ref. HanXRQ genome:   HanXRQChr04 (162407983..162407076)
Protein sequence: HaPNC02HanXRQChr04g0122601
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   130 (104)
PWM (Da):   %s   14516.04 (11770.6)  
PI (pH):   %s   8.72 (8.47) Peptide Signal:   %s   cut: 27 range:27-130
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGDAMVVIMVICLLVMALQCKAYEVLRDHIVGGKSGWNMNYKDENWVGQPGDRTFGAGERYVFKYRKGEHNVVVVNKEGFDNCKTTPTDKVYTSGNDSITLQHGDNYFICSMKGHCPTMRTSRHVP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTGATGCAATGGTGGTAATAATGGTGATATGTCTACTAGTGATGGCGCTGCAATGCAAGGCATATGAAGTGTTAAGAGATCATATCGTTGGTGGTAAAAGTGGT
TGGAATATGAACTATAAAGACGAAAATTGGGTCGGTCAACCCGGTGACCGCACCTTCGGGGCTGGCGAAAGATATG
GTATCCTCTCAACATATCACTGCTTTGTTTGCTAACATTATATA
AATTTAATTTGTAAATTACTCAACAAAATATTTATTTCAGTAAACTACAATTTGAGACCATGTGGTTAATACCCAATGGCACGTAGAGTCACTGTTTGGCAAAATTAAACAATCAAGTCC
ATATGGTTGTCAATTTAAATCCCTGCTAACCGAATTGGTTGGTTAACCGTTAATTGATCAGTGAAATGACTAATAAACCCTCATATTATTATATATAAACTTAAAATAAATAAAAAATCT
TTAGTTGACCCGTGAAATAACTAGAACCTGATCCATACTCCATTTCGGTTGAACCAAGATCAAACCTTCAAACATCAAACTTGTATGAAGAACATCATACCCAGAAAAAAAACCCATACC
TACCACCAACCGTACCACTCGATACCACTGATAGATCTGAACTACCCAGTACCACAACATCATGTTTTCATTTAGTTGTTTAATTGATTAGTTATTTTATGATGTGAACAGTTTTTAAAT
ACCGAAAAGGAGAGCATAATGTTGTGGTAGTGAACAAGGAAGGGTTTGATAATTGCAAGACTACTCCGACCGACAAGGTTTACACAAGTGGAAATGACTCAATTACCCTCCAGCATGGAG
ATAACTACTTCATTTGCAGTATGAAGGGTCATTGTCCTACGATGAGGACCTCAAGGCATGTACCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTGATGCAATGGTGGTAATAATGGTGATATGTCTACTAGTGATGGCGCTGCAATGCAAGGCATATGAAGTGTTAAGAGATCATATCGTTGGTGGTAAAAGTGGT
TGGAATATGAACTATAAAGACGAAAATTGGGTCGGTCAACCCGGTGACCGCACCTTCGGGGCTGGCGAAAGATATG
TTTTTAAATACCGAAAAGGAGAGCATAATGTTGTGGTAGTGAAC
AAGGAAGGGTTTGATAATTGCAAGACTACTCCGACCGACAAGGTTTACACAAGTGGAAATGACTCAATTACCCTCCAGCATGGAGATAACTACTTCATTTGCAGTATGAAGGGTCATTGT
CCTACGATGAGGACCTCAAGGCATGTACCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAACTTTCAA AATCTATGAG TGATTTTTTG GATATAAATT GGTTTCATAT CCACACAAAC AACTCACAAA TGAAACGACA ATAATCATCA AATTAGAAAT CACCATCTCT TCTTGCTTGA  CTAAATAAAT CATGGCTAAG GGAAGAGGTG ATGCAATGGT GGTAATAATG GTGATATGTC TACTAGTGAT GGCGCTGCAA TGCAAGGCAT ATGAAGTGTT AAGAGATCAT ATCGTTGGTG  GTAAAAGTGG TTGGAATATG AACTATAAAG ACGAAAATTG GGTCGGTCAA CCCGGTGACC GCACCTTCGG GGCTGGCGAA AGATATGTTT TTAAATACCG AAAAGGAGAG CATAATGTTG  TGGTAGTGAA CAAGGAAGGG TTTGATAATT GCAAGACTAC TCCGACCGAC AAGGTTTACA CAAGTGGAAA TGACTCAATT ACCCTCCAGC ATGGAGATAA CTACTTCATT TGCAGTATGA  AGGGTCATTG TCCTACGATG AGGACCTCAA GGCATGTACC ATGAAGATTC AAACATTTTC ATCCTGAATT CAAAGTAACA ATAATAATAA TATTATAAAT ACTAATGATA ATGAATAATC  AATAAAATCT ATGTATTTAT GCGTGTACTA AGAGTACCAT ATATTTTAAA TATTGTCATA TGGATTATGG TATAGACAAA TTTCGCTTAT TATAATATTT GGCCTTAAAT TAAGCAATTT 
TAAAGT 

Retrieve as FASTA