Entry information : HaPNC03HanXRQChr04g0122631
Entry ID 14561
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC03HanXRQChr04g0122631
Name HaPNC03HanXRQChr04g0122631
Class Plantacyanin    [Orthogroup: PNC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC03
start..stop
S start..stop
HaPNC02 172 7e-58 1..88 43..130
HaPNC06 101 5e-30 10..82 48..120
HaPNC17 97 7e-28 17..82 53..118
HaPNC08 86 9e-24 17..80 53..116
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 162616088..162616157 70 N° 2 162615489..162615685 197  
complement(join(162615489..162615685,162616088..162616157))


exon

Literature and cross-references HaPNC03HanXRQChr04g0122631
DNA ref. HanXRQ genome:   HanXRQChr04 (162616157..162615489)
Protein sequence: HaPNC03HanXRQChr04g0122631
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   88
PWM (Da):   %s   9987.76  
PI (pH):   %s   8.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYKDENWVGKPGNIIFMAGDRYVFNYRKGEHNVVVVNKEGFDNCKTTPTDKVYTSGKDSITLQHGDNYFICSMKGHCPTMRTSRHVP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTATAAAGACGAAAATTGGGTCGGTAAACCCGGAAACATCATCTTCATGGCTGGCGACAGATATGGTATCCTCTCAACATATCACTGCTTTGTTTGCTAACATTATATAAATTTA
ATTTGTAAATTACTCAACATAATATTTATTTCAGTAACCTACAATTTGAAACCATGTGGTTAATACCCAATCCATACTCCATTGGTGATAGAGGGAGTATGGATTGGGTATCACCAATGG
AGTATGGATTGGGTTAAAATAACTAGAACCTAATCCATACTCCATTTCGGTTGAACCAAGATCAAACCTTCAAACATCAAACTTGTATGAAGAACATCATACCCAGAAAAAAACCCATAC
CTACCATCAACCGTACCACTCGATACCACTGATAGATCTGAACTACCCAGTACCACAACATCATGTTTTCATTTAGTTGTTTAATTGATTAGTTATTTTATGACGTGAACAGTTTTTAAC
TACCGAAAAGGAGAGCATAATGTTGTGGTAGTGAACAAGGAAGGGTTTGATAATTGCAAGACTACTCCGACCGACAAGGTTTACACAAGTGGAAAAGACTCCATTACCCTCCAGCATGGA
GATAACTACTTCATTTGCAGTATGAAGGGTCATTGTCCTACGATGAGGACCTCAAGGCATGTACCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTATAAAGACGAAAATTGGGTCGGTAAACCCGGAAACATCATCTTCATGGCTGGCGACAGATATGTTTTTAACTACCGAAAAGGAGAGCATAATGTTGTGGTAGTGAACAAGGAA
GGGTTTGATAATTGCAAGACTACTCCGACCGACAAGGTTTACACAAGTGGAAAAGACTCCATTACCCTCCAGCATGGAGATAACTACTTCATTTGCAGTATGAAGGGTCATTGTCCTACG
ATGAGGACCTCAAGGCATGTACCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGGACCC CTCTCCCAAC TTGTTTCTAC AAATATCCTA GACATTTACC TAGTTGCAAG TTGTTTACCA AGTGGGACAA GTTGGTGAAC TTGGTGAAAG TAATAAACAT CTAATTACCA  TAATCATCTA AGCACATCTC CTTACTTTTC ACCTTCTTTT TCACACACTT AAGAAATCCT GTCAATCTTC ATATTTTAGC CAAGAACACC TTCAAAAACT TTCACCATTT TAAACTTCTT  TGATGATCAA TATGGAGCTT GATGATACTT AGGATGATCT AAAGACACTA CAAGAAGAAG CAAGCTTTTC TTTCCATTCC ATAGCTTCCA AACATCAAGA TCAACAATTT TTCTTTTCTT  TGATCATCAT ATAGATCGTC CCTAGCCACA AGTGCTAGAA GGTCGCAAAA AGGGACCAAT AATTGGTATC ATAGCAGATT GGATAAATTG TTTCCAAGAT CCCTTCCTCC TGTAAGAGAG  ACGTATATTC TTGATCAGCC AAAGTGATGG CGCTGCAATG CAAGGCATAT GATGTGTTAA GAGATCATAT CGTTGGTGGT AGCAGTGGTT GGAATATGAA CTATAAAGAC GAAAATTGGG  TCGGTAAACC CGGAAACATC ATCTTCATGG CTGGCGACAG ATATGTTTTT AACTACCGAA AAGGAGAGCA TAATGTTGTG GTAGTGAACA AGGAAGGGTT TGATAATTGC AAGACTACTC  CGACCGACAA GGTTTACACA AGTGGAAAAG ACTCCATTAC CCTCCAGCAT GGAGATAACT ACTTCATTTG CAGTATGAAG GGTCATTGTC CTACGATGAG GACCTCAAGG CATGTACCAT  GAAGATTCAA ACATTTTCAT CCTGAATTCA AAGTAACAAT AATAATATTA TTATAAATAC TAATGATAAT GAATAATCAA TAAAATCTAT GTATTTATGC GTGTACTAAG AGTACCATAT 

Retrieve as FASTA