Entry information : HaPNC05HanXRQChr09g0271841
Entry ID 14562
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC05HanXRQChr09g0271841
Name HaPNC05HanXRQChr09g0271841
Class Plantacyanin    [Orthogroup: PNC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC05
start..stop
S start..stop
HaPNC17 149 2e-48 1..122 1..124
HaPNC16 135 2e-42 1..122 1..126
HaPNC18 132 2e-41 1..122 1..118
HaPNC11 130 2e-40 1..121 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 194351323..194351491 169 N° 2 194350994..194351202 209  
complement(join(194350994..194351202,194351323..194351491))


exon

Literature and cross-references HaPNC05HanXRQChr09g0271841
DNA ref. HanXRQ genome:   HanXRQChr09 (194351491..194350994)
Protein sequence: HaPNC05HanXRQChr09g0271841
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125 (99)
PWM (Da):   %s   13597.74 (11042.4) Transmb domain:   %s   o10-32i
PI (pH):   %s   8.21 (8.83) Peptide Signal:   %s   cut: 27 range:27-125
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEGRGGAVVAMAVICLLVVALQCEAASFVVGDKAGWTMNIAGWEKGKTFKAGDTLVFNYQKGQHNVVVKKDPDDISMCSLHPDDKEYKSGKDTVTLNKGPNYIICSFRHHCPQMKLYINASWPI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCGGTGCAGTGGTGGCAATGGCAGTGATATGTCTACTAGTGGTGGCGCTTCAATGCGAGGCAGCTAGTTTTGTGGTTGGTGACAAAGCTGGTTGGACGATGAAT
ATTGCTGGCTGGGAAAAGGGCAAGACATTCAAGGCCGGCGACACCCTTG
GTACCTCTACTTGTTTGCTAACATGTTATATATTTAACAACTAATTTACTCAACATATATAATATTTGTTT
AGTTGGTTTTTTTGTTGTTTAGTTGATTAGTTATTTTATGATGGAACAGTGTTTAACTACCAAAAAGGTCAACATAATGTTGTGGTAAAGAAAGACCCGGACGATATTAGCATGTGCTCC
CTTCACCCAGACGACAAGGAGTACAAAAGTGGAAAAGACACAGTTACCCTTAATAAGGGTCCTAACTACATCATCTGTAGTTTCCGTCATCATTGTCCTCAGATGAAGCTTTACATAAAT
GCATCATGGCCAATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCGGTGCAGTGGTGGCAATGGCAGTGATATGTCTACTAGTGGTGGCGCTTCAATGCGAGGCAGCTAGTTTTGTGGTTGGTGACAAAGCTGGTTGGACGATGAAT
ATTGCTGGCTGGGAAAAGGGCAAGACATTCAAGGCCGGCGACACCCTTG
TGTTTAACTACCAAAAAGGTCAACATAATGTTGTGGTAAAGAAAGACCCGGACGATATTAGCATGTGCTCC
CTTCACCCAGACGACAAGGAGTACAAAAGTGGAAAAGACACAGTTACCCTTAATAAGGGTCCTAACTACATCATCTGTAGTTTCCGTCATCATTGTCCTCAGATGAAGCTTTACATAAAT
GCATCATGGCCAATATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTAACAAA TTAAATGGTG CTTTAGTTAG TTATAAATAG GTTTCATATC CACACAAACA TCCCATAAAT GAAACAACAA TAATAATCTT CAAATTAGAA ATCACCCATC TCTTCATGTC  TGACTAAACC ATGGCTGAGG GAAGAGGCGG TGCAGTGGTG GCAATGGCAG TGATATGTCT ACTAGTGGTG GCGCTTCAAT GCGAGGCAGC TAGTTTTGTG GTTGGTGACA AAGCTGGTTG  GACGATGAAT ATTGCTGGCT GGGAAAAGGG CAAGACATTC AAGGCCGGCG ACACCCTTGT GTTTAACTAC CAAAAAGGTC AACATAATGT TGTGGTAAAG AAAGACCCGG ACGATATTAG  CATGTGCTCC CTTCACCCAG ACGACAAGGA GTACAAAAGT GGAAAAGACA CAGTTACCCT TAATAAGGGT CCTAACTACA TCATCTGTAG TTTCCGTCAT CATTGTCCTC AGATGAAGCT  TTACATAAAT GCATCATGGC CAATATAATA TATATTAGTA ACAATAAAGA AACGATCAAA TCTATGCATT AATTATGTGT GTAGTAAGAG TTTCTTATGC TTTAGTTATA GTTATTTGGA  TTATGGAATA ACAAGTTTCA CTCGTAATAA TATTTGGCTT TAAATTATGT AATTTTAAAG TGTTGTTATC TATGGTATGT TTTATTGTAC ATATATTATT AATTTTGGCA ATGCTTGAAA 
CCAGTGACAG GCCCAGGATT AATTAGGTCC 

Retrieve as FASTA