Entry information : HaPNC06HanXRQChr10g0309721
Entry ID 14563
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC06HanXRQChr10g0309721
Name HaPNC06HanXRQChr10g0309721
Class Plantacyanin    [Orthogroup: PNC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC06
start..stop
S start..stop
HaPNC02 152 3e-49 1..120 1..124
HaPNC17 125 8e-39 1..123 1..121
HaPNC16 120 1e-36 1..124 1..124
HaPNC01 118 5e-36 1..124 1..124
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 207762985..207763168 184 N° 2 207763720..207763916 197  
join(207762985..207763168,207763720..207763916)


exon

Literature and cross-references HaPNC06HanXRQChr10g0309721
DNA ref. HanXRQ genome:   HanXRQChr09 (207762985..207763916)
Protein sequence: HaPNC06HanXRQChr10g0309721
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (100)
PWM (Da):   %s   13482.68 (10837.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.48 (8.98) Peptide Signal:   %s   cut: 27 range:27-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEGKGGTVVVIMVICLLVMALQCDAYPVCSSYVVGGKTGWNKNFNNGWLANVALQPCDKFVFNYPKGKHNVAVVNKTGFDGCKTTPSDKVYTSGKDEIALKDGANYFICSIPGQCPPMKIKVDFT

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAAAGGTGGTACAGTGGTGGTAATAATGGTGATATGTCTACTAGTGATGGCGTTGCAATGCGATGCATATCCTGTTTGTAGTAGTTATGTCGTTGGGGGTAAAACTGGT
TGGAATAAGAACTTTAATAACGGTTGGTTAGCTAACGTTGCGTTACAGCCTTGCGACAAATTTG
GTATCCCCTCAACATATCACTACTTTGTTTGCTAACATTATATACATTTACTATGT
AAATTACTCAACATAATATTTATTTCAGTACACTACAATTAGAGTCCATGTGGTTAATATCCAATGGCACGGTGAGTCCTTATTGGCAAAATTGAACAATCAAGTCCACGTGGTTGTCAA
TTTGAATCAATAAGTTCCCTGCTAACCAAATTCGTTGGCTGACCCATTAGTTGATCGGTGAAATGACTAATATACCGTTATATTATTATAACTAAACTTAAATAAACCTTTCGTTGACCT
GTTAAATGACTAGAACCTGATCCACCAACATGATACATACTCCATTTCGGTAGAACCAAGATTAATAAACCTTCAAACGTCAAACTTGTTTCATGACATCATACCCAGAAAAAAACCCAG
ACCCACCACCACCCATCACCACCATCCCTACCACTCCATACCACCGATAGATCTGAACCACCCACTACCACACATTATGTTTTCCTTTAGTTGTTTTTTTTGTTTAATTGATTTGTTATT
TTATGATGTGAACAGTTTTTAACTACCCAAAAGGAAAACATAATGTTGCGGTAGTGAACAAGACAGGGTTTGATGGGTGCAAGACTACTCCTAGCGATAAGGTTTACACAAGTGGAAAAG
ACGAAATTGCCCTCAAGGACGGTGCTAACTACTTCATTTGCAGTATCCCTGGTCAATGTCCTCCGATGAAGATCAAAGTAGACTTCACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAAAGGTGGTACAGTGGTGGTAATAATGGTGATATGTCTACTAGTGATGGCGTTGCAATGCGATGCATATCCTGTTTGTAGTAGTTATGTCGTTGGGGGTAAAACTGGT
TGGAATAAGAACTTTAATAACGGTTGGTTAGCTAACGTTGCGTTACAGCCTTGCGACAAATTTG
TTTTTAACTACCCAAAAGGAAAACATAATGTTGCGGTAGTGAACAAGACAGGGTTT
GATGGGTGCAAGACTACTCCTAGCGATAAGGTTTACACAAGTGGAAAAGACGAAATTGCCCTCAAGGACGGTGCTAACTACTTCATTTGCAGTATCCCTGGTCAATGTCCTCCGATGAAG
ATCAAAGTAGACTTCACTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACATC AATAATCATA AAAAATAACC AAGCCCTCCA TCTCTTCTTG TTTAACTAAA CCATGGCTGA GGGAAAAGGT GGTACAGTGG TGGTAATAAT GGTGATATGT CTACTAGTGA  TGGCGTTGCA ATGCGATGCA TATCCTGTTT GTAGTAGTTA TGTCGTTGGG GGTAAAACTG GTTGGAATAA GAACTTTAAT AACGGTTGGT TAGCTAACGT TGCGTTACAG CCTTGCGACA  AATTTGTTTT TAACTACCCA AAAGGAAAAC ATAATGTTGC GGTAGTGAAC AAGACAGGGT TTGATGGGTG CAAGACTACT CCTAGCGATA AGGTTTACAC AAGTGGAAAA GACGAAATTG  CCCTCAAGGA CGGTGCTAAC TACTTCATTT GCAGTATCCC TGGTCAATGT CCTCCGATGA AGATCAAAGT AGACTTCACT TGAAGATTCA AATATTTGCA TCATAAATTC AAAATAACAA  TAATAATATA ATAAATATTA GTGATAATGA AGAATCGATC AAATCTATGA ACTTATGCGT GTACTAAAAT TTCGATACGC TTTAATTAAT GTTATATGGA TTATGTTATA GACAAAATTC  GCTCATTATA ATATTTGGCC ATAAATTAAG GAACTTTAAA GTGTTGTTAT CTACGGTACG TTTTATTGTA CATACTAGGT TATAGACCCA TGTTTACATG GGTTTAAGGA TATATAAGTT 
ATATAACTTA ATAATTATGT ATAA 

Retrieve as FASTA