Entry information : HaPNC14 (HanXRQChr11g0340471)
Entry ID 14568
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC14 (HanXRQChr11g0340471)
Name (synonym) HaPNC14 (HanXRQChr11g0340471)
Class Plantacyanin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC14
start..stop
S start..stop
HaPNC22 199 1e-68 1..97 1..97
HaPNC20 199 1e-68 1..97 1..97
HaPNC12 199 1e-68 1..97 1..97
HaPNC11 195 9e-67 1..97 1..97
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111235433..111235610 178 N° 2 111235158..111235273 116  
complement(join(111235158..111235273,111235433..111235610))


exon

Literature and cross-references HaPNC14 (HanXRQChr11g0340471)
Protein ref. GenPept:   78197131 UniProtKB:   Q3AKI6
DNA ref. HanXRQ genome:   HanXRQChr11 (111235610..111235158)
Protein sequence: HaPNC14 (HanXRQChr11g0340471)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97 (68)
PWM (Da):   %s   10081 (7082.5)  
PI (pH):   %s   9.83 (10.28) Peptide Signal:   %s   cut: 30 range:30-97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSEMVSMAVLCLHVAALQCEIAQAATYAAGGNGGWTFNVSGWENGKKFKAGDILVFNYQKGAHNVVVVNKAGYVGCSTTPRNAKIYTSGKDK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
GTATCATCTCAACATCCTATCACTAGTTTACGTGCTTAGTTCTTTTTATAGGTAGCAATTTC
AACCGATTTAGTTAACTTATTCTAAGTTCATTTAAAGTTTTAACAATAACAATAACAATAATAAATGGTTACTTAAAATGATTTTTGATGGGGACAGTGTTCAACTACCAAAAAGGAGCA
CATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGTGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGG
TGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGG GAAGAGGCAG TGAAATGGTG TCAATGGCTG TGCTATGTCT ACACGTGGCG GCACTTCAAT GCGAGATAGC TCAGGCAGCT ACTTATGCCG CCGGCGGTAA TGGTGGCTGG  ACGTTTAACG TCTCCGGCTG GGAAAATGGC AAGAAGTTTA AGGCCGGCGA CATCCTTGTG TTCAACTACC AAAAAGGAGC ACATAATGTG GTGGTTGTGA ACAAGGCAGG GTATGTTGGG 
TGTAGCACTA CCCCAAGAAA TGCAAAGATT TACACAAGTG GTAAAGATAA ATAA 

Retrieve as FASTA