Entry information : HaPNC15 (HanXRQChr11g0340531)
Entry ID 14569
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC15 (HanXRQChr11g0340531)
Name (synonym) HaPNC15 (HanXRQChr11g0340531)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC15
start..stop
S start..stop
HaPNC21 224 3e-77 28..148 6..126
HaPNC19 224 3e-77 28..148 6..126
HaPNC13 224 3e-77 28..148 6..126
HaPNC10 224 3e-77 28..148 6..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111625457..111625536 80 N° 2 111623646..111623809 164 N° 3 111623248..111623450 203  
complement(join(111623248..111623450,111623646..111623809,111625457..111625536))


exon

Literature and cross-references HaPNC15 (HanXRQChr11g0340531)
Protein ref. UniProtKB:   Q41QK0
DNA ref. HanXRQ genome:   HanXRQChr11 (111625536..111623248)
Protein sequence: HaPNC15 (HanXRQChr11g0340531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   148
PWM (Da):   %s   16277.88 Transmb domain:   %s   o20-42i
PI (pH):   %s   4.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIFFFEIFTFLYVFFDILDFFISMIFLGRVMVAMVVLCLLVVAFQCEVALATTYVVGDDNGWTFNVAGWENGKNFNAGDVVFNYPQGAHNVVAVNKEGYDGCSTTPSDAKVYTSGNDQITLVKGFNNFICSYSGHCDSGMKIQISVS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTTTTTTTTGAAATTTTTACTTTTTTATATGTTTTTTTTGATATTTTAGATTTTTTTATTTCTATGATTTTTTTGTAATTTTTTGAATTGTTTTATTATTATGATTTTTTTTTA
TTTTTTTGTTATTTTTTAATATTTTTAGAGTTCATTTATTATATTTTTTAATATGGATCAATCCGGATAGTGATCCGTCCATTTAAAATTAAATTATTTGGATATGGATCGGATCACGAT
CCATTATGTTGGATCATGGATTGGATGATGATCCATTTAAATTGGATCATTAATCGATCGTATCATGATCCAATCCTTATCCATTCATTGACATGAGGGTAATTGGGTCGTTGCATCAGA
AGCTAGTGGAGATAGACGGAGTACACTTTATCTTCTCCAATTTGCTCCAAGTGGGTGCTGCAAAACAACATGAACAACTCGTTAGAAGGGGTCAGAGACCGGGGTCAATGAACCATCCTC
CAACGCTCAAGTTAGTATCGTATTCCTCGTAGTAATCAGAGCACATATGTAAAATGAGTGTAAATTAGAGTAAGAGTAAATGAGGTAAATGGGTATGTTTTCGGAGGAGGGAAGATCCCC
CAAACGAGGGTTGAAACCTTTATTTATAGGTTATGGAGGGCCAAAACCTTAGTTGGGTGTTACTTCCTCACGTTCAAACCTTCAAAGTTCAGATGGTGCATGTGATTTTGTTACGATTTT
CACCCGTTGTTGAATTTGTTCATAAGTGAACAGTTCATGTGTACATGGTTTATATCATTTTGTAAAATACTAGAACCTCTCACACTATTGACAAACATACGTGGGTCACAAAAGTGACTA
GGCTTTATATACGTTTATTCGGGCCGGTCATGGATGAATTAGTTCCTGAAAGACATAGAAGGTTTATTCGGGCTCCCGCGTACTCTTCTTTGTGGTTTTTGTGGAAAGCAAGGAACACAA
AGGTATTTATTTCGATATGGTCATCCTCTTTGAATACGTCCCGTTTGCGGTATACGCATATAATGTATATATGTGTGGGCGTTCGGGGGGCAAAGTGAAAGTGCACTAATTTTAACGTTA
TTTTACTAATTTCGTGAAAATAATGTTAAAAGAGGGTGATGGTTAATCATGGATTATGTGGTGGCGTTGATAGTCGAAAGACAAGGGAGTACATGCACTAATTGGCCTTTGGCCTTTGTC
TTAATTGCCGAGTGTTATGTGCCTTATGTCCAAGGTTTGATACAAAACTACCATCGAGCTGGGGGTCTCACTGGAAGCAGTCTCTCTGTTCCTTCAAGTTAAAGATAAGGTTGTCTACAT
CTTACGCTCCTCAGACTCTACCTTAGTTTTGCTATTAGTAGGATTAAATCTCAAATTATAGTTAAAAAAAAACCCTCCAATGCCAACACCAATTTACAGTGCTTAATTCCCAACATTGAA
AGACATATATTCTACATTGAATACAACATTTATACTCGCTTTAAAAAATTTGATCCATGAGTTTAAAACTGATAATTTATGTCTCATTTCGATACAGACATAAATTATTATGATATATAT
AGTATAAATTTCTCGAAACCGATATATGAGTTATAAATTTTTTTGCTATAAATTGGTTACACATCTACACAAACTTCCCACAAACGAAAAGACAAAAGTCATCAAATAGAAATCACTAAC
ACCCCCCCCCCCCATCTCTCGAGTGAGTGAACCATGGTTGAGGGAAGAGGCCGAGTAATGGTGGCAATGGTGGTGCTTTGTCTACTAGTGGTGGCGTTTCAATGCGAGGTAGCTCTAGCA
ACTACTTATGTTGTCGGGGATGACAATGGTTGGACGTTTAACGTCGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGACGTCCTTG
GTATCCTCTCAACATCCTATCACCACTTT
AGATACATAATTATATATATTTTGTAAAGGTCTCAGTTTCAACCAATTGACTTAACATAATATGTGTTGATAGTAATAACTTTTTTTGGTAAATTAATAATATAATAGTTAAGTAATTAC
AAAGAAATGCTTATTTAGTTCAATTGTTATTATATTATTGGAACAGTGTTTAACTACCCACAAGGAGCACATAATGTGGTAGCCGTGAACAAGGAAGGCTATGATGGGTGCAGCACAACC
CCAAGCGATGCAAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTTTTAACAACTTCATTTGTAGTTACTCTGGTCACTGTGATAGTGGCATGAAGATTCAAATCTCT
GTGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTTTTTTTTGAAATTTTTACTTTTTTATATGTTTTTTTTGATATTTTAGATTTTTTTATTTCTATGATTTTTTTAGGCCGAGTAATGGTGGCAATGGTGGTGCTTTGTCTACTA
GTGGTGGCGTTTCAATGCGAGGTAGCTCTAGCAACTACTTATGTTGTCGGGGATGACAATGGTTGGACGTTTAACGTCGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGACGTC
CTTG
TGTTTAACTACCCACAAGGAGCACATAATGTGGTAGCCGTGAACAAGGAAGGCTATGATGGGTGCAGCACAACCCCAAGCGATGCAAAGGTGTACACAAGTGGAAATGACCAAATT
ACCCTTGTGAAGGGTTTTAACAACTTCATTTGTAGTTACTCTGGTCACTGTGATAGTGGCATGAAGATTCAAATCTCTGTGTCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTTT TTTTTGAAAT TTTTACTTTT TTATATGTTT TTTTTGATAT TTTAGATTTT TTTATTTCTA TGATTTTTTT AGGCCGAGTA ATGGTGGCAA TGGTGGTGCT TTGTCTACTA  GTGGTGGCGT TTCAATGCGA GGTAGCTCTA GCAACTACTT ATGTTGTCGG GGATGACAAT GGTTGGACGT TTAACGTCGC TGGCTGGGAA AACGGCAAGA ATTTCAACGC AGGCGACGTC  CTTGTGTTTA ACTACCCACA AGGAGCACAT AATGTGGTAG CCGTGAACAA GGAAGGCTAT GATGGGTGCA GCACAACCCC AAGCGATGCA AAGGTGTACA CAAGTGGAAA TGACCAAATT 
ACCCTTGTGA AGGGTTTTAA CAACTTCATT TGTAGTTACT CTGGTCACTG TGATAGTGGC ATGAAGATTC AAATCTCTGT GTCTTAA 

Retrieve as FASTA