Entry information : HaPNC16 (HanXRQChr11g0340541)
Entry ID 14570
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC16 (HanXRQChr11g0340541)
Name (synonym) HaPNC16 (HanXRQChr11g0340541)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC16
start..stop
S start..stop
HaPNC11 242 8e-85 1..125 1..125
HaPNC22 240 4e-84 1..125 1..125
HaPNC20 240 4e-84 1..125 1..125
HaPNC12 240 4e-84 1..125 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111626634..111626811 178 N° 2 111626154..111626356 203  
complement(join(111626154..111626356,111626634..111626811))


exon

Literature and cross-references HaPNC16 (HanXRQChr11g0340541)
Protein ref. GenPept:   91070113 UniProtKB:   Q1PKL7
DNA ref. HanXRQ genome:   HanXRQChr11 (111626811..111626154)
Protein sequence: HaPNC16 (HanXRQChr11g0340541)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (97)
PWM (Da):   %s   13035.68 (10105.2)  
PI (pH):   %s   10.15 (10.33) Peptide Signal:   %s   cut: 30 range:30-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSAMVTMAVLCLLVAALQCELAQAATYAIGGNGGWTFNVSGWEKGKKFKAGDVLVFNYQKGAHNVVAVNKAGYVGCSTTPRNAKVYTSGKDQIRLVKGLNSFICSLPGHCGAGMKIQISAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGGTGACAATGGCTGTGTTATGTCTACTAGTGGCGGCACTTCAATGCGAGTTAGCTCAGGCAGCTACTTATGCCATCGGCGGTAATGGTGGCTGG
ACATTTAACGTCTCCGGCTGGGAAAAAGGCAAGAAGTTTAAGGCTGGCGACGTCCTTG
GTATCATCCTATCACTAGTTTACTTGCTTAGTTCTTTTTAGATATAGCAATTTCTACCTATT
TAGTTAACTTATTTCGAGTTCATTTAAAGTTTTAACAGTAACAATAACAATAACAGTAACAGTGTCAGTAAAGTTTTAACACTAACAGTAATAGTAATAATAATAGTAACAGTAACAGTG
TCAGTAAAGTTTTAACAGTAACAGTAACAGTAAGAGTAGTAACAACAATAATAATAATAATAAATGGTTACTTAAATGATTTTTGATGGGCACAGTGTTCAACTACCAAAAAGGAGCACA
TAATGTGGTGGCTGTGAACAAGGCAGGGTATGTTGGGTGCAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATCAAATAAGGCTTGTAAAGGGTCTTAACAGCTTCAT
TTGTAGTCTCCCTGGTCACTGTGGTGCTGGCATGAAGATTCAAATCTCTGCTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGGTGACAATGGCTGTGTTATGTCTACTAGTGGCGGCACTTCAATGCGAGTTAGCTCAGGCAGCTACTTATGCCATCGGCGGTAATGGTGGCTGG
ACATTTAACGTCTCCGGCTGGGAAAAAGGCAAGAAGTTTAAGGCTGGCGACGTCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGCTGTGAACAAGGCAGGGTATGTTGGG
TGCAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATCAAATAAGGCTTGTAAAGGGTCTTAACAGCTTCATTTGTAGTCTCCCTGGTCACTGTGGTGCTGGCATGAAG
ATTCAAATCTCTGCTTCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTGCTATA AATAGGTTTC ATATCCACCC AAACATCTCA CAAACAAAAA GACAAAAGTC ATCAAATCAC CAAATCCTCC ATCTTTTGTC TGAGTGAACC ATGGCTAAGG GAAGAGGCAG  TGCAATGGTG ACAATGGCTG TGTTATGTCT ACTAGTGGCG GCACTTCAAT GCGAGTTAGC TCAGGCAGCT ACTTATGCCA TCGGCGGTAA TGGTGGCTGG ACATTTAACG TCTCCGGCTG  GGAAAAAGGC AAGAAGTTTA AGGCTGGCGA CGTCCTTGTG TTCAACTACC AAAAAGGAGC ACATAATGTG GTGGCTGTGA ACAAGGCAGG GTATGTTGGG TGCAGCACTA CCCCAAGAAA  TGCAAAGGTT TACACAAGTG GTAAAGATCA AATAAGGCTT GTAAAGGGTC TTAACAGCTT CATTTGTAGT CTCCCTGGTC ACTGTGGTGC TGGCATGAAG ATTCAAATCT CTGCTTCTTA  AACAATAAAA TAATGACAAA GAAGACGTTG ATGAAATCTC TAAATTTATA TGGATCAAGT GTTTCTTATG GTTGTTGTTA TATGGTATAA ATAAAAGAGT ATTTGACTTA AATTTAAGGC 
AGTCTTATCA CTTATGTGTT TGTTTTTATT GTATGTTTGG TTATATATGT ATTATTCGTT TTTGGAAATG GTTTGAAAAC TGGAATGGTT TTTAAATTT 

Retrieve as FASTA