Entry information : HaPNC17 (HanXRQChr13g0419491)
Entry ID 14571
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC17 (HanXRQChr13g0419491)
Name (synonym) HaPNC17 (HanXRQChr13g0419491)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue types Buds
Inflorescences
Leaves
Mixed tissues
Roots
Seeds
Siliques
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC17
start..stop
S start..stop
HaPNC18 234 7e-82 1..124 1..118
HaPNC21 195 2e-66 1..124 1..126
HaPNC19 195 2e-66 1..124 1..126
HaPNC13 195 2e-66 1..124 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 173209371..173209548 178 N° 2 173208991..173209187 197  
complement(join(173208991..173209187,173209371..173209548))


exon

Literature and cross-references HaPNC17 (HanXRQChr13g0419491)
Protein ref. UniProtKB:   Q9XEX2   Q2V4E9 [Fragment]   Q8L9P7 [Mismatch]
DNA ref. HanXRQ genome:   HanXRQChr13 (173209548..173208991)
Cluster/Prediction ref. Phytozome Gene 11:   19649394 UniGene:   At.20543
Other ref. AtProteome:   At1g65980 ATTED-II:   At1g65980 e-FP Browser:   At1g65980 Genevestigator:   At1g65980 TAIR:   At1g65980
Protein sequence: HaPNC17 (HanXRQChr13g0419491)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   124 (95)
PWM (Da):   %s   13050.57 (10085.0)  
PI (pH):   %s   8.49 (8.48) Peptide Signal:   %s   cut: 30 range:30-124
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSALVAMVVSCLLLVTLQCELAHAATYVVGDGNGWTFNVAGWEKGKNFNAGDVLVFNYPKGAHNVVVVSKAGYDRCTTTPSDKVYTSGKDQITLVKGLNNVICSFAGHCPSMKIEIFAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTAGTGCATTGGTGGCGATGGTTGTGTCTTGTCTATTACTTGTGACGCTTCAATGTGAGCTAGCTCATGCAGCTACCTATGTCGTCGGTGATGGCAATGGTTGG
ACGTTCAACGTAGCTGGCTGGGAAAAAGGCAAGAATTTCAATGCCGGCGATGTCCTTG
GTATCTTCTCAACATCTTATCATTACTTTCCATGCTTACATGATTATATATTTAGCTAAAAC
CAATGACTTAGCCTAATATGTGTGGATTTCTTTTTTTTATTGGTTAAATTAATAGTAACAATTTAATAACAAAGCAAGTGCTTATTTAATTGAATTATTGTTTATTTTATAATGGAAACA
GTGTTTAATTACCCAAAAGGAGCACATAATGTTGTGGTAGTGAGCAAGGCAGGGTATGATAGGTGCACCACTACCCCAAGCGACAAGGTTTACACAAGTGGGAAAGACCAAATTACCCTT
GTGAAAGGTCTGAACAACGTTATTTGCAGTTTCGCTGGTCATTGTCCTAGCATGAAGATTGAAATCTTTGCATCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTAGTGCATTGGTGGCGATGGTTGTGTCTTGTCTATTACTTGTGACGCTTCAATGTGAGCTAGCTCATGCAGCTACCTATGTCGTCGGTGATGGCAATGGTTGG
ACGTTCAACGTAGCTGGCTGGGAAAAAGGCAAGAATTTCAATGCCGGCGATGTCCTTG
TGTTTAATTACCCAAAAGGAGCACATAATGTTGTGGTAGTGAGCAAGGCAGGGTATGATAGG
TGCACCACTACCCCAAGCGACAAGGTTTACACAAGTGGGAAAGACCAAATTACCCTTGTGAAAGGTCTGAACAACGTTATTTGCAGTTTCGCTGGTCATTGTCCTAGCATGAAGATTGAA
ATCTTTGCATCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGACACTAA TAAACAAATA CGATAATCGC TTAGTCCTTC ATATTTTGTT TCACTGAACC ATGGCTAAGG GAAGAGGTAG TGCATTGGTG GCGATGGTTG TGTCTTGTCT ATTACTTGTG  ACGCTTCAAT GTGAGCTAGC TCATGCAGCT ACCTATGTCG TCGGTGATGG CAATGGTTGG ACGTTCAACG TAGCTGGCTG GGAAAAAGGC AAGAATTTCA ATGCCGGCGA TGTCCTTGTG  TTTAATTACC CAAAAGGAGC ACATAATGTT GTGGTAGTGA GCAAGGCAGG GTATGATAGG TGCACCACTA CCCCAAGCGA CAAGGTTTAC ACAAGTGGGA AAGACCAAAT TACCCTTGTG  AAAGGTCTGA ACAACGTTAT TTGCAGTTTC GCTGGTCATT GTCCTAGCAT GAAGATTGAA ATCTTTGCAT CTTAGAAGGA AAAATAGAAT AATAATAGTA ATAATTCTAA TAAATAATTT 
TACTTCTTTG CATTTATGTT TGTGTTAAAA GAGTTTCTTT TGGTTTAGTT ATTCTTA 

Retrieve as FASTA