Entry information : HaPNC18 (HanXRQChr13g0419501)
Entry ID 14572
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC18 (HanXRQChr13g0419501)
Name (synonym) HaPNC18 (HanXRQChr13g0419501)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC18
start..stop
S start..stop
HaPNC17 234 7e-82 1..118 1..124
HaPNC21 179 4e-60 1..118 1..126
HaPNC19 179 4e-60 1..118 1..126
HaPNC13 179 4e-60 1..118 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 173251634..173251811 178 N° 2 173251256..173251434 179  
complement(join(173251256..173251434,173251634..173251811))


exon

Literature and cross-references HaPNC18 (HanXRQChr13g0419501)
Protein ref. GenPept:   33633845 UniProtKB:   Q7V2W1
DNA ref. HanXRQ genome:   HanXRQChr13 (173251811..173251256)
Protein sequence: HaPNC18 (HanXRQChr13g0419501)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   118 (89)
PWM (Da):   %s   12350.18 (9384.6)  
PI (pH):   %s   8.21 (8.06) Peptide Signal:   %s   cut: 30 range:30-118
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSALVAMVVSCLLLVTLQCELAHAATYVVGDGNGWTFNVAGWEKGKNFNAGDVLGAHNVVVVSKAGYDRCTTTPSDKVYTSGKDQITLVKGLNNFICSFAGHCPSMKIEIFAS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTAGTGCATTGGTGGCGATGGTTGTGTCTTGTCTATTACTTGTGACGCTTCAATGTGAGCTAGCTCATGCAGCTACCTATGTCGTCGGCGATGGCAATGGTTGG
ACATTCAACGTAGCTGGCTGGGAAAAAGGCAAGAATTTCAATGCCGGCGATGTCCTTG
GTATCTTCTTAACATCTTATCATTACTTTCCATGCTTACATGATTATATATTTAGCTAAAAC
CAATGACTTAGCCTAATATGTGTGGATTTCCTTTTTTTTGGTTAAATTGATAGTAACAATTTAATAACAAAGCAAGTGCTTATTTAATTGAATTATTATTTATTTTATGATGGAAATAGT
GTTTAATTACCCAAAAGGAGCACATAATGTTGTGGTAGTGAGCAAGGCAGGGTATGATAGGTGCACCACTACCCCAAGCGACAAGGTTTACACAAGTGGGAAAGACCAAATTACTCTTGT
GAAAGGTCTGAACAACTTTATTTGCAGTTTCGCTGGTCATTGTCCTAGCATGAAGATTGAAATCTTTGCATCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGTAGTGCATTGGTGGCGATGGTTGTGTCTTGTCTATTACTTGTGACGCTTCAATGTGAGCTAGCTCATGCAGCTACCTATGTCGTCGGCGATGGCAATGGTTGG
ACATTCAACGTAGCTGGCTGGGAAAAAGGCAAGAATTTCAATGCCGGCGATGTCCTTG
GAGCACATAATGTTGTGGTAGTGAGCAAGGCAGGGTATGATAGGTGCACCACTACCCCAAGC
GACAAGGTTTACACAAGTGGGAAAGACCAAATTACTCTTGTGAAAGGTCTGAACAACTTTATTTGCAGTTTCGCTGGTCATTGTCCTAGCATGAAGATTGAAATCTTTGCATCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGG GAAGAGGTAG TGCATTGGTG GCGATGGTTG TGTCTTGTCT ATTACTTGTG ACGCTTCAAT GTGAGCTAGC TCATGCAGCT ACCTATGTCG TCGGCGATGG CAATGGTTGG  ACATTCAACG TAGCTGGCTG GGAAAAAGGC AAGAATTTCA ATGCCGGCGA TGTCCTTGGA GCACATAATG TTGTGGTAGT GAGCAAGGCA GGGTATGATA GGTGCACCAC TACCCCAAGC 
GACAAGGTTT ACACAAGTGG GAAAGACCAA ATTACTCTTG TGAAAGGTCT GAACAACTTT ATTTGCAGTT TCGCTGGTCA TTGTCCTAGC ATGAAGATTG AAATCTTTGC ATCTTAG 

Retrieve as FASTA