Entry information : HaPNC19(HanXRQChr17g0535601)
Entry ID 14573
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaPNC19(HanXRQChr17g0535601)
Name HaPNC19(HanXRQChr17g0535601)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC19
start..stop
S start..stop
HaPNC21 258 3e-91 1..126 1..126
HaPNC13 258 3e-91 1..126 1..126
HaPNC10 258 3e-91 1..126 1..126
HaPNC09-1 258 3e-91 1..126 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6954666..6954843 178 N° 2 6954007..6954209 203  
complement(join(6954007..6954209,6954666..6954843))


exon

Literature and cross-references HaPNC19(HanXRQChr17g0535601)
Protein ref. GenPept:   60474043 UniProtKB:   Q55EF1
Protein sequence: HaPNC19(HanXRQChr17g0535601)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (97)
PWM (Da):   %s   13483.42 (10493.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.44 (4.54) Peptide Signal:   %s   cut: 30 range:30-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEGRGSVVVSMVVLCLLVVAFQCEVAQAATYVVGDDNGWTFSVAGWENGKNFNAGDVLVFNYPQGAHNVVVVNKESYDGCNTTPSEAKVYTSGNDQITLVKGYNNFICSYFGHCDSGMKIQIFVS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCAGTGTAGTGGTGTCAATGGTGGTGCTTTGTCTACTAGTGGTGGCATTTCAATGCGAGGTAGCTCAAGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGG
ACGTTTAGTGTTGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGATGTCCTTG
GTATCCTCTCAACATGAGGTCACCACTTTTGTCACTTCAGTCCAAGAATGAAACGTTTTGCA
TCTGGGTCCTGATGTTTCATTTTTGTTGTCATTTTCATCCAATTGGCAAAGTGGGTTAGAATTTTCCGTTAACTACTCCCCTTTTTTTGGTTTCCTCATTTAAATGAAGGGTATAATCGT
CATTTTATGTCATAATATATTTAATTAAATGAGAAAAACGACAAAAAATGTTGAAGTTAACAGAAAATTCTAACTCAGATTGCCAATTGGATTAATATGGCAACAAAAATGAAACGTCAG
GTGCCCAGATGCAAAACGTTTCATTTTTGAACTGAAGTGGTAAAAGTGGCCTAAACTAAAAGACCATTTTGGCATTTTACACTAAAATATAATAGTTAAGTAATTACAAAGAAATGCTTA
TTTTAGTTCAATTGTTATTATATGATTGGAACAGTGTTTAACTACCCACAAGGAGCACATAATGTGGTGGTCGTGAACAAGGAAAGCTATGATGGGTGCAACACAACCCCAAGCGAAGCA
AAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTTATAACAACTTCATTTGTAGTTACTTTGGTCACTGTGATAGTGGCATGAAGATTCAAATCTTTGTATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGGAAGAGGCAGTGTAGTGGTGTCAATGGTGGTGCTTTGTCTACTAGTGGTGGCATTTCAATGCGAGGTAGCTCAAGCAGCTACTTATGTTGTCGGCGATGACAATGGCTGG
ACGTTTAGTGTTGCTGGCTGGGAAAACGGCAAGAATTTCAACGCAGGCGATGTCCTTG
TGTTTAACTACCCACAAGGAGCACATAATGTGGTGGTCGTGAACAAGGAAAGCTATGATGGG
TGCAACACAACCCCAAGCGAAGCAAAGGTGTACACAAGTGGAAATGACCAAATTACCCTTGTGAAGGGTTATAACAACTTCATTTGTAGTTACTTTGGTCACTGTGATAGTGGCATGAAG
ATTCAAATCTTTGTATCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGG GAAGAGGCAG TGTAGTGGTG TCAATGGTGG TGCTTTGTCT ACTAGTGGTG GCATTTCAAT GCGAGGTAGC TCAAGCAGCT ACTTATGTTG TCGGCGATGA CAATGGCTGG  ACGTTTAGTG TTGCTGGCTG GGAAAACGGC AAGAATTTCA ACGCAGGCGA TGTCCTTGTG TTTAACTACC CACAAGGAGC ACATAATGTG GTGGTCGTGA ACAAGGAAAG CTATGATGGG  TGCAACACAA CCCCAAGCGA AGCAAAGGTG TACACAAGTG GAAATGACCA AATTACCCTT GTGAAGGGTT ATAACAACTT CATTTGTAGT TACTTTGGTC ACTGTGATAG TGGCATGAAG 
ATTCAAATCT TTGTATCTTA A 

Retrieve as FASTA