Entry information : HaPNC20 (HanXRQChr17g0535611)
Entry ID 14574
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-08 (Christophe Dunand)
Peroxidase information: HaPNC20 (HanXRQChr17g0535611)
Name (synonym) HaPNC20 (HanXRQChr17g0535611)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC20
start..stop
S start..stop
HaPNC22 256 1e-90 1..125 1..125
HaPNC12 256 1e-90 1..125 1..125
HaPNC11 249 6e-88 1..125 1..125
HaPNC16 240 4e-84 1..125 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111221951..111222128 178 N° 2 111221592..111221791 200  
complement(join(111221592..111221791,111221951..111222128))


exon

Literature and cross-references HaPNC20 (HanXRQChr17g0535611)
Protein ref. UniProtKB:   Q9SRZ4
DNA ref. HanXRQ genome:   HanXRQChr11 (111222128..111221592)
Cluster/Prediction ref. Phytozome Gene 11:   19653389 UniGene:   At.66846
Other ref. TAIR:   At1g65970
Protein sequence: HaPNC20 (HanXRQChr17g0535611)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125 (96)
PWM (Da):   %s   13032.61 (10034.1)  
PI (pH):   %s   9.98 (10.33) Peptide Signal:   %s   cut: 30 range:30-125
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSEMVSMAVLCLHVAALQCEIAQAATYAAGGNGGWTFNVSGWENGKKFKAGDILVFNYQKGAHNVVVVNKAGYVGCSTTPRNAKIYTSGKDKIRLVKGLNSFICSLPGHCGAGMKIQISA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
GTATCATCTCAACATCCTATCACTAGTTTACGTGCTTAGTTCTTTTTATAGGTAGCAATTTC
AACCGATTTAGTTAACTTATTCTAAGTTCATTTAAAGTTTTAACAATAACAATAACAATAATAAATGGTTACTTAAAATGATTTTTGATGGGGACAGTGTTCAACTACCAAAAAGGAGCA
CATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGTGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAACAGCTTC
ATTTGTAGTCTACCTGGTCACTGTGGTGCTGGCATGAAGATTCAAATCTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGG
TGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAACAGCTTCATTTGTAGTCTACCTGGTCACTGTGGTGCTGGCATGAAG
ATTCAAATCTCTGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACAAAAA GACAAAAGTC ATCAAATCAC CAAAGCCTCC ATCTATTGTT TAAGTGAACC ATGGCTAAGG GAAGAGGCAG TGAAATGGTG TCAATGGCTG TGCTATGTCT ACACGTGGCG  GCACTTCAAT GCGAGATAGC TCAGGCAGCT ACTTATGCCG CCGGCGGTAA TGGTGGCTGG ACGTTTAACG TCTCCGGCTG GGAAAATGGC AAGAAGTTTA AGGCCGGCGA CATCCTTGTG  TTCAACTACC AAAAAGGAGC ACATAATGTG GTGGTTGTGA ACAAGGCAGG GTATGTTGGG TGTAGCACTA CCCCAAGAAA TGCAAAGATT TACACAAGTG GTAAAGATAA AATAAGGCTT 
GTAAAAGGTC TTAACAGCTT CATTTGTAGT CTACCTGGTC ACTGTGGTGC TGGCATGAAG ATTCAAATCT CTGCTTGATA AGCAACAAAA TAATGAGGAA AAGAATTTGA AATCT 

Retrieve as FASTA