Entry information : HaPNC11 (HanXRQChr11g0340411)
Entry ID 14576
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC11 (HanXRQChr11g0340411)
Name (synonym) HaPNC11 (HanXRQChr11g0340411)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC11
start..stop
S start..stop
HaPNC22 249 6e-88 1..125 1..125
HaPNC20 249 6e-88 1..125 1..125
HaPNC12 249 6e-88 1..125 1..125
HaPNC16 242 8e-85 1..125 1..125
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111185369..111185546 178 N° 2 111185004..111185203 200  
complement(join(111185004..111185203,111185369..111185546))


exon

Literature and cross-references HaPNC11 (HanXRQChr11g0340411)
DNA ref. HanXRQ genome:   HanXRQChr11 (111185546..111185004)
Protein sequence: HaPNC11 (HanXRQChr11g0340411)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125 (96)
PWM (Da):   %s   13046.62 (10106.2)  
PI (pH):   %s   9.98 (10.17) Peptide Signal:   %s   cut: 30 range:30-125
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSAMVSMAVLCLHVAALQCEIAQAATYAVGGNGGWTFNVSGWENGKKFKAGDILVFNYQKGAHNVVVVNKAGYVGCSTTPRNAKVYTSGKDKIRLVKGLNSFICSLPDHCGAGMKIQISA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGTCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
GTATCATCTCAACATCCTATCACTAGTTTACTTGCTTAGTTCTTTTTATAGGTAGCAATTTC
AACCGATTTAGTTAACTTATTCTAAGTTCATTTAAAGTTTTAACAATAACAATAACAATAACAATAATAAATGGTTACTTAAAATGATTTTTGATGGGGACAGTGTTCAACTACCAAAAA
GGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGTGTAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAAC
AGCTTCATTTGTAGTCTACCTGATCACTGTGGTGCTGGCATGAAGATTCAAATCTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGCAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGTCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGG
TGTAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAACAGCTTCATTTGTAGTCTACCTGATCACTGTGGTGCTGGCATGAAG
ATTCAAATCTCTGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCCATCTAT TGTTTAAGTG AACCATGGCT AAGGGAAGAG GCAGTGCAAT GGTGTCAATG GCTGTGCTAT GTCTACACGT GGCGGCACTT CAATGCGAGA TAGCTCAGGC AGCTACTTAT  GCCGTCGGCG GTAATGGTGG CTGGACGTTT AACGTCTCCG GCTGGGAAAA TGGCAAGAAG TTTAAGGCCG GCGACATCCT TGTGTTCAAC TACCAAAAAG GAGCACATAA TGTGGTGGTT  GTGAACAAGG CAGGGTATGT TGGGTGTAGC ACTACCCCAA GAAATGCAAA GGTTTACACA AGTGGTAAAG ATAAAATAAG GCTTGTAAAA GGTCTTAACA GCTTCATTTG TAGTCTACCT  GATCACTGTG GTGCTGGCAT GAAGATTCAA ATCTCTGCTT GATAAGCAAC AAAATAATGA GGAAAAGAAT TTGAAATCTC TAAACTTATA TGTATCAAGT GCTTCTTATG GTGGTTGTTA 
TATGGTATAA ATAAAAGAGT ATTTGACTTA AATTTAAGGC AG 

Retrieve as FASTA