Entry information : HaSTC02HanXRQChr01g0003051
Entry ID 14577
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC02HanXRQChr01g0003051
Name HaSTC02HanXRQChr01g0003051
Class Stellacyanin    [Orthogroup: STC007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC02
start..stop
S start..stop
HaSTC12 140 5e-43 11..143 10..140
HaSTC19 141 5e-43 2..128 8..134
AtSTC02 127 1e-37 19..127 14..122
ThasSTC02 127 2e-37 11..129 6..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13541403..13541583 181 N° 2 13541715..13542079 365  
join(13541403..13541583,13541715..13542079)


exon

Literature and cross-references HaSTC02HanXRQChr01g0003051
DNA ref. HanXRQ genome:   HanXRQChr01 (13541403..13542079)
Protein sequence: HaSTC02HanXRQChr01g0003051
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181 (160)
PWM (Da):   %s   20064.03 (17571.8)  
PI (pH):   %s   9.12 (8.80) Peptide Signal:   %s   cut: 22 range:22-181
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLKTRMMFHLMLSMIIEGVVMKAVIGEVYSVGDSQGWTILVDSSYSTWASSKSFRVGDTLLFHYNPTAHDVMQVNQHGFRSCNITTPWKTYKTGNDSFIIKAPGHYYFICSFPSHCEAGQKLDVRVLKMSYNLTTTPRANVSSLVPMSTTGSRSVATPATDPNHLLRSLSIVFAAIWVDLL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAAGACAAGAATGATGTTTCATTTGATGTTATCAATGATAATCGAAGGCGTCGTGATGAAGGCGGTGATAGGTGAGGTGTATAGCGTGGGTGATTCTCAGGGTTGGACGATTCTT
GTTGATTCAAGTTACTCGACTTGGGCATCATCAAAAAGTTTTCGTGTTGGTGATACTCTTT
GTAAGTGTAGTTTTGTTTATATAACTAATAAACTCCTATAGAACTTATTTTTATGTACA
ACAATAAAAATAACAATGTGTAACGATAGACAATGATAGTGCGTGCCTGTAAAGTTTTATAATAACATGCAGTGTTTCATTATAACCCAACTGCCCACGACGTGATGCAAGTGAACCAAC
ATGGTTTCCGATCATGCAACATAACCACACCGTGGAAAACCTACAAAACTGGTAACGACTCATTCATTATTAAGGCGCCCGGGCATTACTACTTCATATGCAGTTTTCCAAGCCATTGTG
AAGCCGGCCAAAAGCTCGATGTTAGGGTCCTTAAAATGAGTTATAATCTAACCACCACTCCACGCGCAAATGTTAGCTCACTAGTGCCAATGAGCACCACCGGATCAAGGTCGGTTGCAA
CACCTGCAACCGACCCTAACCATTTGCTTAGGAGTTTGTCCATAGTTTTTGCTGCGATTTGGGTCGATTTGTTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAAGACAAGAATGATGTTTCATTTGATGTTATCAATGATAATCGAAGGCGTCGTGATGAAGGCGGTGATAGGTGAGGTGTATAGCGTGGGTGATTCTCAGGGTTGGACGATTCTT
GTTGATTCAAGTTACTCGACTTGGGCATCATCAAAAAGTTTTCGTGTTGGTGATACTCTTT
TGTTTCATTATAACCCAACTGCCCACGACGTGATGCAAGTGAACCAACATGGTTTCCGA
TCATGCAACATAACCACACCGTGGAAAACCTACAAAACTGGTAACGACTCATTCATTATTAAGGCGCCCGGGCATTACTACTTCATATGCAGTTTTCCAAGCCATTGTGAAGCCGGCCAA
AAGCTCGATGTTAGGGTCCTTAAAATGAGTTATAATCTAACCACCACTCCACGCGCAAATGTTAGCTCACTAGTGCCAATGAGCACCACCGGATCAAGGTCGGTTGCAACACCTGCAACC
GACCCTAACCATTTGCTTAGGAGTTTGTCCATAGTTTTTGCTGCGATTTGGGTCGATTTGTTATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAAGA CAAGAATGAT GTTTCATTTG ATGTTATCAA TGATAATCGA AGGCGTCGTG ATGAAGGCGG TGATAGGTGA GGTGTATAGC GTGGGTGATT CTCAGGGTTG GACGATTCTT  GTTGATTCAA GTTACTCGAC TTGGGCATCA TCAAAAAGTT TTCGTGTTGG TGATACTCTT TTGTTTCATT ATAACCCAAC TGCCCACGAC GTGATGCAAG TGAACCAACA TGGTTTCCGA  TCATGCAACA TAACCACACC GTGGAAAACC TACAAAACTG GTAACGACTC ATTCATTATT AAGGCGCCCG GGCATTACTA CTTCATATGC AGTTTTCCAA GCCATTGTGA AGCCGGCCAA  AAGCTCGATG TTAGGGTCCT TAAAATGAGT TATAATCTAA CCACCACTCC ACGCGCAAAT GTTAGCTCAC TAGTGCCAAT GAGCACCACC GGATCAAGGT CGGTTGCAAC ACCTGCAACC 
GACCCTAACC ATTTGCTTAG GAGTTTGTCC ATAGTTTTTG CTGCGATTTG GGTCGATTTG TTATAG 

Retrieve as FASTA